Details for Chinese cabbage Locus Brara.D00334

Position : A04 ( 5`- 2376795 .. 2377929 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.D00334

Protein [Map View]
MATTNLIATSNGVRFFSSSSLGNPDHFLSRRLSQTNHRDRFQTSLCYRQMSLKDVKPVVKTEIRGKSYFVTGATGFLGKV
LVEKLLRESPEIGKIFILMKSKDQESANKRLYDEIISSDLFKLLKQMHGSSYEAFMKSKLIPVTGDIGEENLGMDSETAD
KISEEIDVIINTAGRTTFDDRYDAALSVNALGPDRLLSFGEECKKLKLFLHVSTAFVTGKLEGTVLETPLCFGENITSDL
NIETEVKLASEAARKFHG

DNA
ATGGCTACGACAAATCTCATAGCCACAAGCAACGGCGTCAGATTCTTCTCCTCCTCCTCCTTAGGCAATCCAGACCACTT
CTTGTCTCGTCGTTTGTCACAGACGAATCATAGAGACAGATTCCAAACTTCTTTGTGTTATCGTCAGATGTCGTTGAAAG
ATGTGAAACCGGTTGTTAAGACTGAGATCAGAGGAAAGAGTTATTTTGTTACAGGTGCAACAGGGTTTCTTGGGAAAGTG
TTGGTCGAGAAACTGTTGAGAGAAAGTCCTGAGATAGGGAAGATTTTTATTCTGATGAAATCCAAAGATCAAGAATCAGC
CAACAAAAGACTCTATGATGAGATCATCAGCTCGGATCTGTTCAAGCTTCTGAAGCAAATGCATGGGAGCTCATATGAAG
CTTTCATGAAGAGCAAGTTGATTCCAGTAACTGGAGACATCGGAGAGGAGAATCTAGGGATGGATTCCGAAACAGCAGAC
AAGATTAGTGAGGAGATTGATGTCATTATAAACACTGCTGGACGTACAACATTCGACGACAGATACGACGCTGCCCTAAG
TGTAAATGCTCTTGGACCTGATAGGCTCTTAAGCTTCGGAGAGGAATGCAAGAAGCTGAAACTTTTCCTTCACGTTTCAA
CTGCTTTTGTGACTGGTAAGTTAGAGGGAACAGTACTAGAGACTCCTCTCTGCTTTGGAGAAAACATAACTTCTGACTTG
AACATCGAAACCGAGGTGAAACTAGCTTCAGAAGCTGCAAGAAAGTTCCATGGC