Details for Chinese cabbage Locus Brara.C03670

Position : A03 ( 5`- 18898502 .. 18902379 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.C03670

Protein [Map View]
MNFLLRSASSATHRPPVSEPPPATPPQPPPPEATKPGSTLEGLISEEPFPQYPSVDEDHLGDGSRDDHGNGEANANTGGF
GMERFSDVSEDEGWISIPYKEIPDNWSESVDIESLRSLDRSFVFPGEQIQILACLSESKGDAEIITPFKVAEVMSRAVQR
KLSDNGTSTPSGDGETSPDGQFAAQNGDSPGKESSDSQKDVSDGESILRMEDHQRRTEDLLSKFQKSHFFVRIAESGEPL
WSKKSSLVGDRELDKKRPCVSAFVDRGEFDPNVAGGVARSKAKCIALPNGDIVVSLQVYIVDCPKEPIIEILQFEKHQDG
KDSDSYGNLLKWLIPLDNTISQQPRSLPPPVSSSTPGGISSSNAHKTSLSSGSGSQLFSFGHFRSYSMSALPAPNTAPVT
GPVKTQSSKPSFDLEDWDSYSGQTLRKSGTEELLSFRGVPLERDRFSVRCGLEGICIPGRRWRRKLEIIQPIDINSFAAD
CNTDDLLCVQIKNVAPTHTPDIVIYIDAITIVFEEAGKSASPSSVPIACIEAGNEHSLPNLTLRKGEEHSFIVKPAFSVG
SNLKPSAARKELKSSSLSLPSVNFERLGSGLSGDHYAVMVSCRCNYTESRLFFKQRTKWRPRVSRDLMISVASEMSGEPC
GPHGRASQLPVQILTLQASNLTTEDLSLTVLAPASFTSPPSVVSLNSTPTSPISPFLGFSEFTERVQTEKRNTTTRKVQS
LPSFPLETRTEATTNDEMNPSSDVVPKSGLGCTHLWLQSRVPLGCVPSKSTATIKLELLPLTDGIITLDTLQIHVKEKGR
RYIPEQSLKINATSSISSGIF*

DNA
ATGAATTTCTTGCTCCGATCTGCTTCCTCCGCTACTCACCGCCCTCCGGTGAGCGAACCGCCACCAGCTACCCCGCCTCA
GCCTCCTCCTCCCGAAGCAACCAAGCCCGGATCCACTTTGGAAGGGCTCATATCCGAGGAGCCTTTCCCGCAGTATCCAT
CAGTGGATGAGGATCATTTGGGTGATGGATCTAGAGACGACCATGGTAATGGAGAGGCAAATGCAAACACTGGTGGCTTT
GGGATGGAGAGGTTCTCAGATGTGTCTGAGGATGAAGGATGGATCTCTATTCCATATAAGGAGATTCCGGATAACTGGTC
TGAGTCTGTTGATATTGAGTCACTACGTTCTCTAGATCGCTCCTTTGTGTTTCCTGGGGAGCAGATTCAGATCCTTGCGT
GCTTATCTGAAAGCAAAGGAGACGCAGAGATCATCACCCCTTTTAAAGTAGCTGAGGTGATGAGCAGAGCTGTACAGAGA
AAGCTCTCTGACAATGGGACGAGTACACCGTCAGGAGATGGAGAAACAAGCCCTGATGGTCAGTTTGCAGCTCAGAACGG
TGACAGTCCTGGGAAAGAGAGTTCGGATTCGCAAAAGGATGTATCTGATGGCGAATCGATCTTGAGGATGGAAGATCATC
AGAGAAGAACAGAGGACTTGCTTTCAAAGTTTCAGAAGTCTCATTTCTTCGTTAGGATTGCAGAGTCCGGCGAGCCGCTT
TGGTCAAAGAAAAGCTCTCTGGTGGGAGATAGAGAGTTAGACAAGAAGAGACCTTGTGTTAGTGCTTTTGTAGATAGAGG
AGAGTTCGATCCTAATGTTGCTGGAGGTGTAGCTAGAAGTAAGGCTAAATGCATTGCCTTACCCAATGGAGACATAGTGG
TCTCTTTACAAGTTTATATCGTTGACTGTCCCAAAGAGCCCATCATTGAGATACTTCAGTTTGAGAAGCATCAGGACGGT
AAAGATAGTGACTCGTATGGGAACCTTTTGAAGTGGTTGATACCGTTGGACAACACTATCTCTCAGCAACCACGTTCTTT
ACCACCTCCTGTAAGCTCATCCACCCCAGGAGGTATCAGCAGCAGCAATGCACACAAGACATCACTCTCTTCCGGCTCAG
GGTCTCAGCTCTTCTCATTCGGCCATTTTAGAAGCTACTCCATGTCAGCTCTCCCGGCGCCGAACACTGCACCGGTTACT
GGACCTGTGAAAACTCAAAGCTCCAAACCATCGTTTGATCTTGAAGATTGGGATAGTTACTCAGGTCAGACACTAAGGAA
GTCTGGGACTGAAGAGCTCTTATCTTTCCGGGGTGTCCCATTGGAGAGGGATAGATTCTCTGTTCGTTGTGGACTCGAAG
GCATCTGCATCCCTGGGAGAAGATGGAGGAGGAAACTTGAAATTATTCAACCTATTGATATTAATTCTTTTGCAGCTGAT
TGTAATACAGATGATCTTCTCTGCGTTCAGATAAAGAATGTTGCTCCTACACACACTCCAGATATTGTTATATACATAGA
CGCTATAACAATTGTTTTTGAAGAGGCAGGGAAGAGTGCTTCCCCTTCTTCGGTACCAATTGCTTGTATTGAAGCTGGTA
ACGAGCACAGTTTGCCCAATTTAACTCTCAGGAAAGGGGAGGAGCATTCGTTCATTGTGAAACCTGCTTTCTCTGTTGGG
AGTAATCTGAAGCCTTCTGCTGCGAGGAAAGAACTCAAGTCATCGAGTTTGTCTCTTCCTTCTGTAAATTTTGAAAGACT
AGGGAGCGGTTTAAGTGGTGATCATTATGCGGTGATGGTGTCATGTCGGTGCAACTACACAGAATCAAGGCTGTTTTTCA
AACAACGGACAAAGTGGAGACCGAGAGTTTCTAGGGACCTGATGATCTCTGTTGCGTCTGAAATGTCAGGAGAGCCTTGT
GGCCCTCATGGGAGAGCCTCACAGCTACCTGTTCAGATTTTGACTCTTCAAGCATCTAATTTGACAACTGAAGATCTGTC
TTTAACGGTTCTAGCTCCAGCATCCTTCACATCACCTCCCTCTGTGGTGTCCCTAAACTCCACGCCTACCTCCCCTATAA
GCCCATTCCTAGGATTCTCCGAGTTCACAGAGAGGGTACAAACCGAAAAACGCAACACAACAACGCGTAAAGTGCAGTCG
TTACCTTCATTTCCGCTGGAGACAAGGACAGAGGCAACAACTAATGATGAAATGAATCCTTCTTCAGATGTTGTTCCAAA
GAGCGGCTTGGGTTGTACACATCTCTGGCTACAAAGTCGGGTTCCCTTGGGATGTGTTCCTTCGAAATCTACAGCAACAA
TCAAGCTAGAGTTACTTCCTTTGACTGACGGCATAATCACTCTGGATACTCTCCAAATCCACGTCAAGGAGAAAGGTCGA
AGGTACATTCCAGAGCAGTCACTCAAGATAAATGCGACGTCAAGCATTTCCTCTGGGATCTTCTAG