Details for Chinese cabbage Locus Brara.C03665

Position : A03 ( 5`- 18865216 .. 18866332 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.C03665

Protein [Map View]
MVHGYGHVKILCAELQDFMKQHNFSTIEDFRGHSLQYFTTHTDLVKRQKEAIEQRKAERRGLKSDKDWTRDGFVKETESM
VSN*

DNA
ATGGTACATGGCTATGGTCATGTGAAAATCCTCTGCGCCGAGCTTCAAGATTTTATGAAACAGCACAACTTCTCTACTAT
AGAAGACTTCAGAGGGCATTCGCTTCAGTACTTTACAACACATACAGATTTAGTCAAGAGACAGAAAGAAGCTATTGAGC
AGAGAAAAGCCGAGAGGAGAGGCTTGAAATCTGATAAAGATTGGACCAGAGATGGGTTCGTGAAGGAGACTGAGAGTATG
GTTTCTAACTAA