Details for Chinese cabbage Locus Brara.C03656

Position : A03 ( 5`- 18812042 .. 18815563 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.C03656

Protein [Map View]
MKMTKSSSPSFSTFHNSLDSLLHFCPSFLFFLAGLFVFLFKPFCSPRFCLDMASPMENDDVPMLPASDTSSSSRTMPFTS
RSRSTSLANNSSTIDVFNSSTVVLGYTDPLGTQRRPPLVQVSYPLSSTRSPEPRFALPPPSTGASYDSVGASSSQPNERN
HAYSRKAAQSRTPRVFATSDFTLHNALDDDAKGWAKYFSGIIYPESNYVQLWTTFFVLSCLCSIFVDPLFFYPIEIYKEE
RCIKIDWWTTNVFVIVRTITDGLYALNIVLQFRLAYVDLESTVAGAGQLVDDPKKIASHYLRGKFLTDFFIVLPIPQILL
LWIIPQLLGTSGANNTKNYLRAAILVQYIPKLRRLFPLLAGQTPRGFRFDSALAKFFINLLTFMLAGHVIGSCWYLLGLQ
RVNQCLRDACGNSSFECKQLIDCGRENRTEVLHAWKINVSANACFQEDGFDYGIYLKAVNLTSNCTRWYRRYSYSLFWGF
QQISTLAGNQVPSYFFGEVLFTMCIIGLGLFLFALLIDGTMIRMPSKGLLSSRDVWCVTNVEAFSLSVADLEDITSLFPN
LEIPKEP*

DNA
ATGAAAATGACTAAGTCATCATCTCCTTCCTTCTCAACTTTCCATAACTCTTTAGACTCTCTGCTTCACTTCTGCCCTAG
CTTCTTGTTTTTTCTTGCTGGTCTCTTTGTTTTCCTCTTTAAACCTTTCTGTAGCCCAAGGTTTTGTCTCGATATGGCTT
CTCCCATGGAGAACGATGATGTTCCCATGCTTCCAGCTTCAGACACATCATCATCATCTCGTACTATGCCTTTCACTTCC
AGGTCACGTAGCACTTCCCTTGCAAACAATTCTTCCACCATTGACGTATTCAACAGCTCGACAGTTGTTTTAGGCTACAC
AGATCCTCTTGGAACCCAGAGACGGCCTCCATTAGTGCAAGTGAGTTACCCTCTTTCCTCTACTCGTAGTCCTGAGCCTC
GCTTTGCTCTTCCTCCTCCTTCTACTGGTGCTTCTTATGATTCCGTTGGTGCCTCCTCCTCTCAGCCTAATGAGAGGAAT
CATGCCTACAGCCGCAAAGCTGCTCAAAGCCGCACTCCCAGAGTTTTTGCCACTTCTGATTTCACGCTCCATAACGCTCT
TGATGATGATGCTAAAGGCTGGGCTAAATACTTTTCTGGAATCATATATCCTGAGTCTAATTACGTTCAGCTCTGGACTA
CATTCTTTGTCTTATCATGCTTGTGTTCTATTTTCGTAGATCCCCTCTTTTTCTACCCCATAGAAATATATAAGGAGGAG
AGATGCATTAAGATCGACTGGTGGACGACTAATGTATTTGTAATTGTGAGAACTATAACGGATGGCTTATACGCTTTGAA
CATCGTGCTTCAGTTCCGATTGGCATATGTAGATCTTGAGTCTACGGTTGCTGGTGCTGGCCAGTTGGTTGATGATCCAA
AAAAAATTGCTAGCCATTACTTACGAGGAAAATTTTTGACAGACTTTTTCATAGTGTTGCCGATTCCACAGATATTGCTA
TTATGGATAATACCACAACTGTTAGGCACATCTGGGGCAAACAATACAAAGAACTATTTACGTGCTGCAATTCTTGTCCA
ATACATTCCAAAATTACGTAGGCTTTTTCCTCTTCTAGCCGGACAAACACCAAGAGGGTTCAGATTTGATTCGGCATTGG
CCAAGTTTTTTATAAATCTTCTCACCTTCATGCTTGCTGGTCATGTTATTGGCTCTTGCTGGTATCTTTTGGGTCTGCAG
AGAGTTAATCAGTGCCTTCGAGATGCTTGCGGAAATTCTAGTTTTGAATGCAAACAACTAATAGATTGTGGTCGTGAAAA
CAGAACGGAAGTTTTACATGCATGGAAAATTAATGTTAGTGCCAATGCTTGTTTTCAAGAGGATGGTTTTGATTATGGAA
TATATTTGAAGGCAGTCAATCTCACTAGTAATTGTACTCGTTGGTACAGAAGATACAGTTACTCTCTTTTCTGGGGATTT
CAGCAAATCAGCACGCTTGCTGGAAACCAAGTCCCAAGTTACTTTTTTGGGGAGGTCTTATTTACTATGTGTATCATCGG
ACTGGGGCTTTTCCTTTTCGCGCTTCTTATCGATGGGACTATGATAAGGATGCCATCAAAGGGACTGCTTAGCAGCAGAG
ATGTTTGGTGTGTGACAAACGTGGAGGCGTTTTCACTCAGTGTAGCAGATCTGGAAGACATCACGAGCTTGTTCCCCAAT
CTCGAGATTCCTAAGGAGCCATAA