Details for Chinese cabbage Locus Brara.C03652

Position : A03 ( 5`- 18788361 .. 18789853 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.C03652

Protein [Map View]
MSYNIFFILMLTLVHSTFSSLSPPDRAALESIRDSLTDMPGSSFFSTWDFTTPDPCSTFSGLACTSLGRVTTLSLGPNLS
GSLSPSISNLTHLTQLVLYPGSVTGPLPPRFDSLPLLRVISLTRNRLTGPIPNSFSSLSYLHTLDLSYNQLSGSIPHFLT
TLPRLKVLVLASNQFSNNLKPVSSPLLHLDLKMNQISGQLPPAFPTTLRYLSLSSNSMQGTINALAPLTELTYIDLSMNQ
FTGAIPNSLFGPTTSSMFLQRNNFTSISNATAISLPQGSTVDMSHNSISGELPPSLAGAESLFLNNNRFAGDIPEEYVRS
LTNGTTKTLFLQHNYLTRFPWNSGSQLQDSVSLCLSYNCMETDPVVGLSTCPVEVAPLLSRPAIQCSRFYNHSSTG*

DNA
ATGAGCTACAACATTTTCTTCATCCTTATGCTCACTCTCGTCCACTCCACTTTCTCTTCACTATCTCCACCAGACCGAGC
CGCGCTCGAATCCATCAGAGACTCTTTAACCGATATGCCAGGCTCATCCTTCTTCTCAACTTGGGACTTCACAACCCCTG
ACCCTTGTTCCACCTTCTCAGGTCTCGCTTGCACTTCTCTCGGCCGTGTCACCACCTTATCTCTCGGCCCTAACCTCTCC
GGTTCACTCTCTCCTTCTATCTCCAACCTAACCCATTTAACCCAACTCGTTCTCTACCCCGGTTCAGTCACCGGTCCTCT
CCCTCCTCGGTTCGATTCCCTCCCTCTCCTTCGAGTCATTTCCTTAACCAGAAACCGCTTAACCGGTCCTATACCCAATT
CTTTCTCATCTCTTTCATACCTCCACACTCTTGACCTTAGCTATAACCAACTCTCAGGCTCTATCCCTCATTTCCTCACT
ACACTTCCACGACTCAAAGTCCTTGTCTTAGCCTCGAACCAGTTCTCCAACAACCTTAAACCTGTCTCTAGCCCTTTGCT
CCATTTAGACCTAAAAATGAACCAAATCTCCGGCCAACTCCCACCAGCTTTCCCCACCACTCTCCGGTACTTATCCCTCT
CCTCAAACTCAATGCAAGGCACAATCAACGCCTTGGCGCCATTAACAGAGCTAACATACATCGATCTCAGCATGAACCAA
TTCACCGGGGCCATCCCTAACTCACTCTTTGGTCCAACAACCTCATCAATGTTCTTACAACGAAACAACTTCACTTCAAT
CTCCAACGCCACCGCCATTTCATTACCTCAAGGCTCCACCGTTGATATGAGCCATAACTCTATCTCTGGAGAGTTACCTC
CTTCGCTCGCCGGAGCAGAGTCTCTGTTCTTGAACAATAACCGTTTCGCAGGAGATATTCCAGAGGAATACGTCAGAAGC
TTAACCAACGGTACGACGAAAACGCTCTTCTTGCAACATAACTACTTGACGAGATTCCCTTGGAACTCTGGTTCTCAACT
ACAGGACTCTGTTTCGCTCTGTTTGTCATATAACTGCATGGAGACGGATCCAGTCGTCGGTTTGTCCACGTGTCCGGTAG
AAGTTGCACCTCTGCTCTCAAGGCCTGCTATACAATGTTCTCGCTTTTACAATCACAGCTCCACTGGTTGA