Details for Chinese cabbage Locus Brara.C03650

Position : A03 ( 5`- 18780922 .. 18781997 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.C03650

Protein [Map View]
MVPKKRKKKAKVFGSIFSISSYSLYSGLHQISKDNTILMSLQRPNGNSSSSSSPKKRTTEESDEELLMVPDMEAAGSTGV
LSSSADDGVNNPEIEVEQTQNATSTAKRRRGRNPEDKEYRSLKRLLRNRVSAQQARERKKVYVSDLESRANELQNNNEQL
EEKISTLMNENTMLRKMLINTRPKADDN*

DNA
ATGGTCCCCAAGAAGAGAAAGAAAAAAGCAAAAGTCTTTGGTTCGATATTCTCTATTTCCTCTTACTCTCTCTACTCTGG
TCTTCATCAAATCTCAAAAGACAATACTATATTGATGTCTCTTCAACGACCCAATGGGAACTCGAGTTCTTCTTCTTCCC
CCAAGAAGCGCACAACTGAGGAGAGTGATGAAGAGTTGTTGATGGTTCCAGACATGGAAGCAGCTGGATCAACAGGTGTT
CTAAGCAGCAGCGCCGACGACGGAGTCAACAATCCGGAGATTGAAGTTGAACAGACCCAAAATGCAACCTCCACCGCTAA
GCGCCGCCGTGGACGAAATCCAGAGGATAAAGAATACAGAAGCCTTAAGAGATTGTTGAGAAACCGAGTATCTGCTCAAC
AAGCGAGGGAGAGGAAGAAAGTGTATGTGAGTGATTTGGAATCAAGAGCTAATGAGTTGCAGAACAATAATGAGCAGCTT
GAGGAGAAGATTTCTACTTTGATGAACGAGAACACAATGCTTCGCAAGATGCTTATTAACACAAGGCCTAAAGCTGATGA
CAATTAA