Details for Chinese cabbage Locus Brara.C03649

Position : A03 ( 5`- 18776957 .. 18779622 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.C03649

Protein [Map View]
MHASSICNSYSSSSVDSTKHSASESSVNLSLSLTFPSTSPQRATKQDWPPIKPRLIDTLKGRRRLLQRDYDTCLFVKVYM
EGVPIGRKLDLSTFSGYESLLENLSHMFNTSIICGNHRDRKHHVLTYQDTDGDWMMVGDIPWEMFLETVRRLKITKPERC
*

DNA
ATGCATGCTAGCTCGATTTGTAACTCTTATTCCTCATCCTCTGTCGACAGTACTAAGCATTCAGCTTCTGAATCTTCTGT
TAATCTCTCCCTTAGTCTCACATTTCCCTCTACTTCTCCACAAAGAGCGACAAAACAAGATTGGCCCCCTATAAAACCTC
GTTTAATAGATACACTAAAGGGTCGTCGTCGTCTTCTTCAACGCGATTACGACACATGTCTGTTTGTTAAGGTTTATATG
GAAGGTGTTCCCATTGGGAGAAAGCTCGATCTTTCCACATTCTCAGGCTACGAGAGTCTATTAGAAAATCTGTCTCACAT
GTTCAATACTTCAATTATCTGCGGTAATCATCGAGATAGAAAACACCATGTTTTGACATATCAAGACACAGATGGAGATT
GGATGATGGTCGGAGATATTCCATGGGAAATGTTTCTTGAAACCGTGAGAAGACTGAAGATCACGAAACCAGAGAGGTGT
TAA