Details for Chinese cabbage Locus Brara.C03648

Position : A03 ( 5`- 18773869 .. 18774620 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.C03648

Protein [Map View]
MASWKKTIATPFKKAATLFNQPQQSPRKGCGGGKMDAKAREEHERRMVRELQGEVMACGYDDVLVMWSILDKSNSSNNLT
S*

DNA
ATGGCATCATGGAAGAAAACAATAGCAACACCATTCAAGAAGGCAGCAACACTCTTCAACCAACCGCAGCAATCGCCAAG
AAAGGGTTGCGGCGGTGGAAAAATGGATGCCAAAGCGAGGGAAGAGCACGAGAGGAGGATGGTAAGAGAGCTTCAAGGAG
AAGTCATGGCTTGTGGATACGACGATGTTCTCGTCATGTGGTCTATTCTCGACAAATCTAACTCCTCCAATAACCTCACT
TCTTAA