Details for Chinese cabbage Locus Brara.C03645

Position : A03 ( 5`- 18753874 .. 18754710 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.C03645

Protein [Map View]
MGLGRRVIVSLVIMAIVTMCCVQGTIAKEAAKGKSWTDWAKEKIGLKHEEKIPTTHTTTTVEDNAWGATDKAKDAKDAAK
RKAEEAVGATYETAKSKAGETIGSLKDKASQSYDSVGQVYKDSFSGDNSDKSWTDWAKEKIGIKHNENYPNMGDTVSEKA
KEAKDAATHKAGDAKERLEETVEAAKEKASDLTSAAKEKAEKLKEEAERESKNAKEKSKEHYENAKSKAEETLESAKDKA
SQSYDSAAKESEEARIPCHTSQNELRILASTKTMSSRM*

DNA
ATGGGTTTAGGGAGGAGAGTTATCGTATCTTTGGTAATTATGGCTATTGTAACGATGTGTTGTGTCCAAGGCACCATCGC
CAAAGAAGCGGCTAAGGGTAAATCATGGACTGATTGGGCCAAGGAGAAGATCGGTCTGAAGCATGAAGAGAAGATCCCGA
CCACTCACACCACCACAACGGTCGAAGACAACGCTTGGGGAGCGACTGATAAGGCCAAGGACGCTAAGGACGCCGCCAAA
CGCAAGGCAGAGGAAGCCGTTGGAGCTACTTACGAGACAGCAAAATCGAAAGCAGGCGAGACTATTGGCTCCTTGAAAGA
CAAGGCATCGCAGAGCTATGATTCAGTAGGTCAAGTTTATAAAGACAGTTTCTCGGGGGATAATAGCGATAAATCATGGA
CTGATTGGGCTAAAGAGAAAATCGGAATCAAACACAACGAAAACTACCCTAACATGGGGGACACGGTGTCAGAGAAGGCT
AAAGAAGCAAAGGACGCAGCCACACACAAAGCGGGAGACGCTAAGGAGAGGTTGGAGGAAACGGTTGAGGCGGCTAAGGA
GAAGGCGAGTGATCTGACGAGTGCGGCCAAGGAGAAAGCCGAGAAATTGAAGGAAGAAGCGGAGAGAGAGAGTAAGAATG
CGAAGGAGAAGAGTAAAGAACACTACGAGAATGCAAAATCCAAAGCTGAGGAGACTTTGGAGTCTGCGAAAGATAAAGCG
TCTCAAAGCTATGACTCAGCTGCTAAGGAATCAGAGGAAGCTAGGATACCTTGTCACACAAGTCAAAACGAGTTAAGGAT
ACTAGCTTCAACGAAGACGATGAGCTCTAGAATGTGA