Details for Chinese cabbage Locus Brara.C03642

Position : A03 ( 5`- 18715054 .. 18717383 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.C03642

Protein [Map View]
MASNIPMSPQLEQIHGEIRDHFRALANGFQKLDKIKDSTRQSKQMEELTDKMRECKRLVKEFDRELKDEEARNSPQVNKQ
LNDEKQSMIKELNSYVALRKTYMSTLGNKKVELFDMGAGVSGEPTAEDNVQVASSMSNQELVDAGMKRMDETDQAIERSK
QVVEQTLEVGTQTAATLKGQTDQMGRVVNHLDTIQFSIKKASQLVKEIGRQVATDKCIMMFLFLIVCGVVAIIIVKIVHP
NNKDIRDIPGLAPPAQSRKLLYLRNQEYMGK*

DNA
ATGGCTTCCAACATCCCGATGAGCCCTCAATTAGAGCAGATCCATGGTGAAATCCGTGACCATTTCCGAGCCCTCGCGAA
TGGTTTTCAGAAGTTGGATAAGATCAAGGATTCAACTAGACAAAGCAAGCAGATGGAGGAACTTACTGACAAGATGAGAG
AATGTAAAAGGTTGGTGAAGGAGTTTGACCGTGAACTCAAGGATGAGGAAGCTAGAAATTCTCCTCAAGTAAATAAGCAA
TTGAACGATGAGAAACAATCCATGATCAAGGAACTCAACTCCTACGTTGCACTAAGGAAAACGTATATGAGTACACTTGG
AAACAAGAAAGTTGAACTATTTGATATGGGAGCTGGAGTCAGTGGCGAACCTACCGCTGAAGACAATGTTCAAGTGGCTT
CATCTATGTCAAACCAGGAGCTTGTAGATGCTGGAATGAAAAGAATGGATGAGACTGATCAAGCCATTGAGCGCTCAAAA
CAAGTTGTAGAGCAAACACTCGAAGTTGGAACTCAAACAGCAGCTACTTTAAAGGGACAGACGGATCAAATGGGGCGAGT
GGTTAACCACTTGGACACGATTCAGTTCTCTATCAAGAAGGCTTCCCAGCTAGTGAAAGAGATAGGAAGACAGGTGGCTA
CTGATAAATGCATAATGATGTTCCTGTTTCTCATTGTATGCGGTGTTGTAGCCATTATCATAGTGAAGATTGTACACCCG
AATAACAAAGACATAAGGGACATACCAGGATTAGCTCCTCCAGCACAATCAAGGAAGCTATTATACTTGAGGAATCAAGA
ATATATGGGAAAATAG