Details for Chinese cabbage Locus Brara.C02094

Position : A03 ( 5`- 10446116 .. 10448034 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.C02094

Protein [Map View]
MSSGGNTHWCHRCQRAVRLHGRDPVCSYCGGGFVELLEIPQASPFDMLRSHRDVVERDPTFDLMDALSDFMRNRETRGRS
ISSGPENFPGLAPLLIFGGQVPYRLSGIESLFNGGSPGIGITRGNNTGDYFFGPGLEELFEQLSAGTTTRRGPPPAPRSS
IDALPTIKIAQRHLRSSDSNCAVCKDEFELGAEAKQMPCNHIYHSDCIVPWLVQHNSCPVCRQELPSGRGSSSSQNRTTT
RNNRSSSSSSGNSRESSNERRNPFSSFWPFRSSGSTSNSTQNRGGTRNSDGTDENHNYHQQQQQQSHMGYGGWPFDY*

DNA
ATGTCAAGCGGTGGAAACACCCACTGGTGCCATAGATGCCAGCGTGCTGTCAGGCTACACGGACGAGACCCTGTATGTTC
TTATTGTGGAGGAGGGTTTGTTGAGCTGCTTGAAATCCCTCAAGCCAGCCCATTTGATATGCTCAGATCTCACAGGGATG
TTGTGGAACGTGATCCTACTTTTGATCTCATGGATGCTTTGTCCGACTTTATGAGGAACCGAGAAACCAGAGGAAGATCC
ATCAGCTCTGGTCCTGAGAACTTCCCTGGTCTGGCTCCTCTCTTAATCTTTGGTGGTCAGGTTCCTTACAGACTATCTGG
AATCGAATCCCTCTTCAACGGCGGCTCGCCTGGCATTGGCATCACACGTGGTAACAACACTGGTGACTATTTCTTCGGTC
CTGGTCTTGAAGAGCTCTTTGAGCAGCTTTCAGCTGGGACTACTACTCGCAGAGGACCACCACCTGCTCCTAGATCTTCA
ATAGATGCATTGCCTACCATCAAGATCGCTCAGAGGCATCTTAGGTCTTCGGACTCCAACTGTGCTGTGTGTAAAGACGA
ATTTGAATTGGGAGCAGAAGCGAAACAGATGCCTTGTAACCATATCTATCATTCTGACTGCATTGTCCCGTGGCTGGTTC
AGCATAACTCATGTCCGGTCTGTCGCCAAGAGCTACCATCAGGTAGAGGATCTTCGAGTAGTCAAAACAGAACCACCACC
AGAAACAACAGAAGTAGTAGTAGTAGTAGTGGTAATAGCCGTGAGAGCAGCAATGAAAGAAGGAATCCTTTCTCTTCCTT
CTGGCCATTTCGTTCGTCTGGTTCAACCTCAAACTCCACACAGAACCGTGGAGGGACAAGAAACTCGGATGGAACCGATG
AGAATCATAACTACCATCAGCAGCAACAGCAACAGTCACATATGGGTTATGGTGGTTGGCCTTTTGATTACTAA