Details for Chinese cabbage Locus Brara.C02090

Position : A03 ( 5`- 10424805 .. 10426543 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.C02090

Protein [Map View]
MDSDSNNTKSIKRNVVDQLVEGYESATQLQLLLSHQQSNHHIDQTRIVSGDPDPVNELMDKILDSFHKTISVLDSFDQVA
NVSVVLEGSRNASCGDDSTPASCNGGDSGDSRKRLGVGKSKRGCYTRKKRSHTWTMEARRINEDIYAWRKYGQKQILNSK
FPRSYFRCTHKPTQGCNATKQVQKHEQDPSLFQITYIGHHTCNVSDETQAKTEPLDLEIVMDSDNNKLAATISQDHVDPY
IQEQGNDISSLIGVGASMVKEEDYNNGDQNKDYCEGSSTYSDLSLVWPDVMMSDDRQHHQNHFYHGEASTTTSYQFSFID
NDQFSSLFDSYCPYEGTSAI*

DNA
ATGGACTCAGATAGTAACAATACCAAATCCATTAAGAGAAACGTTGTGGACCAACTTGTTGAAGGCTACGAATCCGCTAC
TCAGCTTCAGCTTCTCCTCTCTCATCAACAATCTAATCACCACATCGATCAGACTCGTATTGTTTCAGGAGATCCGGATC
CAGTTAATGAGCTCATGGATAAGATCTTGGATTCTTTCCACAAAACCATATCGGTTCTTGATTCTTTTGACCAAGTCGCC
AACGTCTCCGTCGTCCTTGAGGGTTCACGGAATGCTTCATGCGGCGATGATTCAACTCCGGCAAGTTGCAACGGTGGAGA
TTCGGGCGATAGTAGAAAGAGACTTGGAGTTGGTAAAAGTAAAAGAGGATGCTACACTAGAAAAAAGAGATCACATACTT
GGACTATGGAAGCTAGAAGAATTAATGAAGATATATATGCTTGGAGGAAATATGGACAAAAGCAGATTCTTAACTCCAAG
TTCCCAAGAAGTTATTTTAGATGCACACACAAGCCAACACAAGGATGCAATGCAACAAAGCAAGTTCAGAAACATGAGCA
AGACCCTTCTTTGTTTCAAATCACTTACATTGGCCACCATACATGTAACGTTAGTGATGAAACACAAGCAAAGACCGAGC
CTCTTGATCTCGAAATAGTCATGGATTCGGACAATAATAAATTGGCAGCAACCATTTCTCAGGACCATGTGGATCCATAT
ATACAAGAGCAAGGGAACGACATCAGTAGCCTGATCGGAGTAGGCGCAAGCATGGTGAAGGAGGAGGATTATAACAATGG
TGATCAGAATAAAGACTATTGTGAGGGTTCTTCCACATATAGTGATTTGTCATTGGTTTGGCCAGACGTGATGATGTCTG
ATGATCGTCAACATCATCAGAATCACTTCTATCACGGTGAAGCTAGTACTACTACTTCTTATCAATTCTCTTTCATTGAC
AACGATCAATTCTCCTCCTTGTTTGATTCCTACTGCCCTTACGAAGGAACAAGTGCTATATGA