Details for Chinese cabbage Locus Brara.C02085

Position : A03 ( 5`- 10406648 .. 10407815 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.C02085

Protein [Map View]
MNSGSCSSLMEVGYDHHHHHHGHEELHVLAVDDNLIDRKLVEKLLKISSCKVTTAENAIRALEYLGLGDQNQHIDALTNN
DLKVNLIITDYCMPGMTGFELLKKVKESSNLKEVPVVIMSSENIPTRINKCLASGAQMFMQKPLKLSDVEKLKCHLMNCR
S*

DNA
ATGAATAGTGGTTCTTGTTCATCTTTAATGGAGGTGGGTTATGATCATCATCATCATCATCATGGTCATGAAGAGCTTCA
TGTTTTGGCCGTGGATGATAATCTTATTGACCGTAAACTTGTAGAGAAGTTGCTCAAGATCTCCTCTTGCAAAGTTACAA
CAGCAGAGAATGCCATTAGAGCATTGGAGTATTTGGGTTTGGGAGATCAAAATCAGCATATTGATGCACTGACCAATAAT
GATTTGAAGGTGAATCTAATCATCACAGACTATTGCATGCCAGGGATGACAGGCTTCGAGCTACTCAAGAAAGTGAAGGA
GTCATCAAATCTGAAAGAGGTCCCTGTTGTGATAATGTCATCAGAGAACATTCCTACTCGCATCAACAAATGTTTAGCTA
GTGGAGCTCAAATGTTTATGCAGAAGCCTCTGAAACTATCGGATGTTGAGAAACTTAAATGTCATCTCATGAACTGCAGA
AGCTGA