Details for Chinese cabbage Locus Brara.C02079

Position : A03 ( 5`- 10380637 .. 10381788 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.C02079

Protein [Map View]
MTFKRRNGGRNKHNRGHVKPIRCSNCGKCCPKDKAIKRFIVRNIVEQAAIRDVQEASVYDGYTLPKLYAKTQYCVSCAIH
SHVVRVRSRTNRRVRTPPPRFVRRKEDAPKPGQPGQAPRPAGAAAAPRA*

DNA
ATGACTTTCAAGCGCAGGAACGGAGGGAGGAACAAGCACAACCGTGGGCACGTGAAGCCAATCAGATGCTCCAACTGCGG
CAAATGTTGCCCAAAGGACAAGGCCATCAAGAGGTTCATCGTGAGGAACATTGTGGAGCAGGCTGCTATTAGAGATGTTC
AGGAAGCTAGCGTCTACGATGGGTACACATTGCCTAAGCTGTATGCTAAGACGCAGTACTGTGTCTCATGTGCGATACAC
TCTCACGTTGTTAGAGTTCGTTCCCGTACCAACCGTAGGGTTCGTACTCCCCCGCCTCGTTTTGTTAGACGCAAGGAGGA
TGCTCCCAAGCCTGGGCAACCTGGTCAGGCTCCTCGTCCTGCTGGAGCTGCAGCTGCCCCGCGTGCCTGA