Details for Chinese cabbage Locus Brara.C02076

Position : A03 ( 5`- 10372533 .. 10374461 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.C02076

Protein [Map View]
MAEEEHQSCVHDVNIRTKSENFDPVGVSHAPGIRKVSSRAEIDTSPPFGSVQEAVTWFGGRGYWVPFKLQDNYNCVGEYN
IKKMEEHAAELEKNLIVKELETLDILEALGSTKRIVEDLKRQLHQESLRSAEQIKEMNNEHYNHNPTSSPDMILMELKQA
KINLSKTMDDLAMIQSSVESLNKKMKEEKEFLDKTREKLTYGFGGAVSLAEELSRVRVKPDEKPREHVKMIAETGLNQQN
KNCLRTAEMRLVAARKMEEAARAAEALAIAEIAMLSSEEDSEFCFPEPPESPLTPRGLRNVTDFSTNHSSRSGILKKLEE
ATQGVKQSKQDLEAALNRVEIANVKQLAAENAFRGWTKHTPTSQTRRSFFRHLNKQNEPVLKSNVSMRDVLRRKQVPKEE
AVVSERQSIEGQRRNVNLSQMLRELKHDIKSSVRGEKEEVREEKQFVTQRRKFGFIHITLPMQKQSKKKTSI*

DNA
ATGGCAGAGGAGGAGCATCAGAGTTGTGTCCATGATGTGAATATTCGAACCAAGTCCGAGAATTTCGACCCGGTTGGTGT
TTCTCATGCACCCGGGATAAGGAAAGTGAGTTCCAGAGCTGAGATTGATACTTCTCCTCCATTCGGTTCGGTTCAGGAGG
CGGTGACTTGGTTCGGTGGTCGTGGCTATTGGGTTCCTTTCAAGCTTCAAGACAATTACAATTGTGTGGGAGAATATAAC
ATAAAGAAAATGGAAGAGCATGCAGCAGAGCTAGAGAAGAATCTAATAGTGAAAGAGCTGGAAACTCTAGATATTCTAGA
AGCACTTGGCTCCACTAAGAGGATTGTTGAAGACTTAAAGCGACAACTTCATCAAGAATCCTTGAGATCAGCTGAACAGA
TCAAAGAGATGAACAATGAGCATTACAATCACAACCCCACGTCATCTCCCGATATGATCTTAATGGAACTGAAGCAAGCC
AAGATAAATCTTAGTAAAACCATGGATGATCTTGCGATGATCCAGTCCTCTGTTGAGTCTCTAAACAAGAAAATGAAGGA
AGAGAAAGAGTTTCTTGACAAGACAAGAGAGAAGCTCACGTATGGGTTTGGAGGAGCGGTGTCTCTAGCTGAGGAGCTGA
GTAGAGTTAGGGTGAAACCAGATGAAAAACCAAGAGAACATGTGAAGATGATCGCTGAAACGGGTCTTAACCAACAGAAC
AAGAACTGTCTGAGAACTGCGGAGATGAGACTGGTTGCTGCTAGAAAAATGGAAGAAGCTGCAAGAGCTGCGGAAGCACT
AGCCATTGCTGAGATAGCAATGTTATCATCCGAGGAAGATTCAGAGTTTTGCTTTCCAGAGCCTCCTGAATCTCCCTTAA
CACCGAGAGGACTTAGGAATGTTACTGACTTCTCCACCAATCATAGCTCAAGAAGTGGGATTTTGAAGAAGCTTGAGGAA
GCTACACAAGGAGTTAAACAAAGCAAACAAGACTTGGAAGCTGCGTTAAACCGAGTAGAGATAGCTAACGTGAAGCAACT
CGCAGCTGAAAACGCTTTCCGCGGGTGGACAAAACACACACCTACGAGTCAAACCCGACGCTCTTTTTTCAGACATCTGA
ACAAGCAGAACGAGCCAGTTCTAAAGTCTAATGTCTCGATGCGTGATGTTTTGAGGCGTAAGCAAGTTCCGAAGGAAGAG
GCTGTTGTCTCCGAGAGGCAGAGTATTGAAGGACAGAGACGGAATGTGAACTTGAGTCAAATGCTGAGGGAGCTGAAGCA
TGATATTAAGTCTTCTGTACGAGGTGAGAAAGAGGAGGTACGTGAAGAGAAACAGTTTGTCACGCAGAGGAGAAAGTTTG
GGTTCATACACATTACGCTTCCCATGCAGAAGCAGAGTAAGAAGAAAACTAGCATTTAA