Details for Chinese cabbage Locus Brara.B03355

Position : A02 ( 5`- 28109125 .. 28110478 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.B03355

Protein [Map View]
MDLRLSTCKIQMTTSRLIIITMTMLMMRTGDSMRLDLESGMTKCISDDIKMNYLTVGTYSVVNPNEAIHLPASHKIFVTV
ASPKGHTQHQAENVESGKFVFTAVEDGDYTTCFIAPVFKPPAKFAVDFEWKSGVEAKDWATIAKRGQINMLEVEVRKLLD
VTESIHDEMFLLREREREMQELNRSTNSRMAGLSLFSLVVTLFVAGLQLWHLKSFLERKKLL*

DNA
ATGGATTTGCGATTATCAACATGCAAGATTCAGATGACAACGTCAAGATTGATCATCATAACGATGACAATGTTGATGAT
GAGAACCGGAGACTCGATGAGATTGGATCTGGAATCAGGCATGACCAAATGTATCTCAGACGACATCAAAATGAATTATC
TGACTGTGGGTACTTATTCCGTCGTCAATCCCAACGAAGCTATCCATCTTCCTGCTTCCCACAAAATTTTTGTCACTGTG
GCGTCACCTAAAGGGCACACTCAACACCAAGCAGAAAATGTGGAGTCTGGGAAATTCGTTTTCACGGCGGTGGAAGACGG
CGATTACACAACGTGTTTTATTGCTCCTGTTTTTAAACCTCCGGCCAAATTCGCCGTTGATTTCGAATGGAAAAGTGGCG
TGGAGGCTAAAGATTGGGCCACCATCGCCAAGAGAGGCCAGATCAACATGCTGGAGGTGGAGGTGAGGAAACTACTAGAC
GTGACGGAGTCTATACACGACGAAATGTTTCTACTCCGGGAGAGGGAGCGGGAAATGCAGGAGCTAAACCGGTCGACGAA
CTCGAGAATGGCGGGTCTAAGTTTATTCTCGTTGGTGGTTACGTTGTTTGTAGCCGGTTTACAACTATGGCATCTCAAGT
CATTCTTGGAGAGGAAGAAGCTTCTCTAA