Details for Chinese cabbage Locus Brara.B03351

Position : A02 ( 5`- 28092776 .. 28093806 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.B03351

Protein [Map View]
MDVSCSQEYPFDLHCGGAFNGFGENNAVELSNKRSMLKESDGFKKKKKQRGSSRVCSRGHWRISEDSQLMELVALYGPQN
WNHIAEKMQGRRTGKSCRLRWFNQLDPRINKRAFSVEEEERLLAAHRAFGNKWAMIAKLFNGRTDNALKNHWHVLMARKL
RQQSTSYLRRFNESSYNPTSDHKTFTLPPGLYDGEDMNLVKKSWKTLKEEYTTNLKAQYLQEEYCSLRMPMQGPHHHCST
FPADSLALTLHVSIQEPSLSSSSCAEHRVVARYFETTKPPAFIDFLGVGHHQSPKI*

DNA
ATGGATGTTTCTTGTTCCCAAGAATACCCTTTTGATCTTCATTGCGGAGGAGCATTTAATGGCTTTGGAGAAAACAATGC
AGTGGAGCTCTCTAATAAAAGAAGCATGCTGAAGGAGAGTGATGGATTCAAGAAGAAGAAGAAGCAGAGAGGTTCTTCTA
GGGTTTGTAGTAGAGGACACTGGAGAATCTCTGAGGACTCTCAGCTCATGGAGCTTGTTGCCCTTTACGGTCCTCAAAAC
TGGAACCACATTGCAGAGAAGATGCAAGGAAGAAGAACAGGCAAGAGTTGCAGATTGAGGTGGTTTAACCAGCTAGACCC
AAGGATCAACAAAAGAGCTTTCAGTGTTGAGGAAGAAGAGAGGCTACTTGCAGCTCACAGAGCATTTGGCAACAAATGGG
CTATGATTGCTAAGCTTTTCAATGGAAGAACAGACAATGCATTGAAGAATCACTGGCATGTCCTCATGGCAAGAAAGTTG
AGGCAGCAATCAACTTCATACCTCAGGAGATTCAATGAGTCTTCTTATAATCCTACTTCAGATCACAAAACCTTCACTCT
TCCTCCTGGTTTGTATGATGGTGAAGATATGAATTTGGTAAAGAAGAGCTGGAAAACGCTAAAAGAAGAGTATACAACTA
ACCTGAAAGCTCAGTATCTGCAAGAAGAGTATTGTTCTTTGCGCATGCCAATGCAGGGCCCACATCATCACTGCTCAACC
TTCCCTGCAGATTCCTTGGCACTGACACTGCATGTCTCCATCCAGGAACCATCACTGTCGTCATCATCATGTGCAGAACA
TAGAGTGGTGGCCAGATATTTTGAGACCACCAAACCTCCAGCTTTTATAGATTTTCTTGGGGTCGGCCACCACCAAAGCC
CCAAGATTTAG