Details for Chinese cabbage Locus Brara.B03140

Position : A02 ( 5`- 26206712 .. 26207958 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.B03140

Protein [Map View]
MKLLQASLCLISLLLVLPSIFAASSSEDFDFFYFVQQWPGSYCDTQKSCCYPTSGKPAADFGIHGLWPNYKDGTYPSNCD
ATKPFDSSTISDLVSSMKRNWPTLACPSGSGEAFWEHEWEKHGTCSQSVINQHEYFQTSLGLKQKTNLLGALTKAGINPD
GNSYSLESIRGSIKASTGFTPWIECNRDGSGNSQLYQVYLCVDRSASGLIECPVFPHGKCGAQIEFPSF*

DNA
ATGAAGCTTCTTCAAGCATCACTGTGTCTGATCAGTCTTCTCCTAGTCCTACCTTCGATCTTCGCTGCTTCTTCCTCTGA
AGACTTTGATTTCTTCTACTTCGTCCAACAATGGCCAGGATCATACTGTGACACACAGAAGAGTTGTTGTTATCCAACTT
CAGGCAAGCCAGCAGCTGATTTTGGTATTCATGGTCTTTGGCCTAACTACAAAGATGGAACTTATCCATCTAACTGTGAC
GCCACTAAACCATTCGATTCATCAACGATATCGGATCTAGTCAGCTCAATGAAGCGGAACTGGCCTACACTTGCTTGCCC
AAGCGGCTCAGGAGAGGCGTTCTGGGAACACGAATGGGAGAAGCACGGTACTTGCTCCCAATCGGTTATCAACCAGCATG
AGTATTTTCAAACCTCTCTTGGCCTTAAGCAGAAAACCAATCTTCTTGGAGCTCTTACTAAAGCCGGGATTAATCCGGAT
GGGAACTCGTACAGTTTAGAGAGCATAAGAGGCTCGATTAAAGCGTCAACGGGCTTCACTCCTTGGATTGAGTGTAACAG
AGATGGGTCTGGGAATAGCCAATTGTACCAAGTCTATCTATGTGTTGACCGGTCTGCTTCCGGTTTAATTGAATGCCCGG
TTTTCCCTCATGGAAAATGTGGAGCCCAGATTGAATTCCCTTCTTTTTAA