Details for Chinese cabbage Locus Brara.B02148

Position : A02 ( 5`- 13488041 .. 13490305 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.B02148

Protein [Map View]
MEVVCGDSDNLKNRPLTPLRTLRGLIILLIFLSTAFMFLIYFAPPFALALRLLSVHQSRKSISFIFGHWLALWPYLFEKV
NGTTVIFSGDTLPVEKRVLLIANHRTEVDWMYLWNIALRKGCLGYIKYVLKSSLMRLPIFGWGFHVLEFIPVERKREVDE
PVMLQMLSTFKDPREPLWLALFPEGTDFTEEKCKRSQKFAAEAGLPTLSNVLLPKTKGFSVCLEALHNSLDAVYDLTIAY
KPRCPSFMDNVFGTDPSEVHIHVKRVLAKEIPASEAESSAWLMDSFKSKDRLLSDFNAQGQFPNQRPEEELSILKCIATF
GVIVSLTVLFLYLTLYSHSCFKVYVALSFTYLSFATYYKFRPSPSVGSCKGGSCKESKTH*

DNA
ATGGAAGTAGTTTGCGGAGACTCTGATAACTTAAAGAACCGCCCCTTGACTCCTCTTAGGACTCTGAGAGGTCTCATCAT
CTTACTCATCTTCCTCTCTACTGCCTTCATGTTCCTCATCTACTTCGCACCACCTTTTGCTCTAGCTCTACGCCTTCTCA
GCGTCCACCAATCTAGAAAATCTATATCCTTCATCTTTGGTCACTGGCTAGCTCTATGGCCTTACCTCTTCGAAAAAGTC
AACGGAACAACAGTAATTTTCTCCGGAGACACCCTTCCCGTAGAGAAACGTGTTTTGCTAATAGCAAACCACAGGACAGA
GGTGGACTGGATGTATCTTTGGAACATCGCATTGAGGAAAGGCTGTCTTGGTTACATCAAGTACGTCCTCAAGAGCAGCT
TGATGAGGCTGCCTATCTTCGGCTGGGGGTTTCATGTTCTTGAGTTCATACCAGTTGAGAGGAAGCGTGAGGTGGACGAG
CCTGTTATGCTTCAAATGCTTTCAACGTTTAAAGACCCTCGTGAGCCCTTGTGGCTAGCTCTCTTCCCTGAAGGAACTGA
CTTCACTGAAGAGAAATGCAAGAGAAGCCAAAAGTTTGCAGCCGAAGCTGGTCTTCCAACGCTATCAAACGTACTTTTAC
CGAAGACAAAAGGCTTTAGCGTTTGCTTAGAAGCTCTACATAACTCTTTGGACGCAGTATACGATTTGACCATCGCATAC
AAGCCTCGCTGCCCATCTTTCATGGACAATGTATTCGGTACTGATCCTTCAGAAGTTCACATCCACGTAAAGCGAGTTCT
AGCAAAGGAGATTCCAGCAAGCGAGGCAGAGTCTTCTGCTTGGTTAATGGATTCGTTTAAGTCCAAGGACAGGCTGCTAT
CTGATTTCAATGCTCAAGGGCAGTTCCCAAATCAAAGACCAGAAGAAGAACTATCTATTCTCAAGTGCATTGCAACATTT
GGAGTGATAGTATCTTTGACGGTACTGTTTCTTTATCTGACCTTGTATTCACATAGCTGTTTCAAAGTATATGTTGCTCT
AAGCTTCACATATTTGTCTTTTGCTACTTACTACAAGTTCCGGCCCTCACCATCTGTTGGCTCTTGTAAAGGAGGTTCTT
GTAAAGAATCAAAAACCCATTAA