Details for Chinese cabbage Locus Brara.B02147

Position : A02 ( 5`- 13481417 .. 13483411 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.B02147

Protein [Map View]
MWSWNILFKNGDVLQGTWREDLTHGKGWFYFNKGDRWFANFWKGNASGEGRFYSKSGEIFFGHFKDGW*

DNA
ATGTGGTCTTGGAACATTCTATTCAAGAATGGAGACGTGTTACAAGGCACATGGCGAGAAGATTTAACACACGGAAAGGG
GTGGTTTTATTTCAACAAAGGTGATAGATGGTTTGCAAATTTCTGGAAAGGAAATGCCAGCGGTGAAGGAAGGTTCTATT
CAAAGTCAGGTGAGATATTCTTTGGACATTTCAAAGATGGATGGTGA