Details for Chinese cabbage Locus Brara.B02146

Position : A02 ( 5`- 13477298 .. 13480551 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.B02146

Protein [Map View]
MVAASSCYAYLDFRPCNHYNNNNNNNIALSSLFGSNSISLNQNQSRLNRATNSGRAMAIAMNMENEAMVSKNNPPMEKRR
VVVTGMGVETSLGHDPHTFYENLLQGNSGISHIEDFDCSDFPTRIAGEIKSFSTEGWVAPKLSRRMDKFMLYLLTAGKKA
LADGGVTEQVMAEFDKAKCGVLIGSALGGMKVFHEAIQALKISYKKMNPFCVPLATTNMGSAMLAVDLGWMGPNYSISSA
CATSNFCILNSANHIIKGEADVMLCGGSDAAIIPIGLAGFVAVRALSQRNNDPAKASRPWDCNRDGFVIGEGAGVLLLEE
LEHAKKRGATIYAEFLGGSFTCDAYHMTEPHPDGAGVIICIERALAHAGIPKEQINYVNAHATSTPAGDLKEYKALVHCF
GQNPELKVNSTKSMIGHLLGAAGAVEAVATVQAIRTGWVHPNINLDNPENGVDTKLLVGSKKERLNIKAALSNSFGFGGH
NSSIIFAPYK*

DNA
ATGGTGGCTGCCTCTTCCTGTTACGCCTATTTGGACTTTAGGCCTTGCAATCACTACAACAACAACAACAACAACAACAT
TGCCTTGTCTTCTCTCTTCGGATCAAATAGTATTTCTTTGAATCAAAACCAGAGTAGATTGAACCGAGCAACTAACTCCG
GTAGAGCCATGGCTATTGCTATGAATATGGAAAATGAAGCCATGGTTAGCAAGAATAATCCCCCTATGGAGAAGCGTCGG
GTTGTGGTGACAGGCATGGGAGTTGAAACATCATTAGGTCATGACCCACATACCTTTTACGAGAACTTGCTACAAGGAAA
CAGTGGTATTAGCCACATTGAGGATTTTGATTGTTCTGACTTTCCTACGAGAATCGCGGGTGAGATCAAATCTTTCTCCA
CTGAAGGATGGGTTGCTCCTAAACTGTCTAGGAGGATGGACAAGTTCATGCTCTATCTCCTCACTGCTGGCAAGAAAGCT
TTGGCTGATGGTGGTGTAACCGAACAAGTCATGGCTGAGTTTGACAAAGCCAAATGTGGCGTTTTGATTGGCTCTGCACT
GGGTGGCATGAAGGTCTTTCATGAGGCTATTCAAGCTTTGAAGATCTCTTACAAGAAGATGAATCCTTTTTGTGTTCCTC
TTGCTACAACTAACATGGGTTCTGCTATGCTTGCTGTTGATCTGGGGTGGATGGGGCCAAACTACTCTATTTCAAGTGCT
TGTGCTACAAGCAACTTCTGCATTCTGAATTCAGCTAACCACATTATTAAGGGTGAAGCTGATGTAATGCTATGTGGTGG
CTCAGATGCAGCTATTATTCCAATAGGGTTGGCAGGTTTCGTGGCAGTCCGGGCTCTTTCACAAAGGAATAATGATCCCG
CAAAAGCTTCACGTCCTTGGGATTGTAATCGAGATGGTTTCGTGATTGGGGAGGGAGCTGGAGTTCTGCTTTTGGAAGAA
CTTGAGCATGCTAAGAAAAGAGGAGCAACTATCTACGCAGAGTTTCTTGGTGGGAGCTTCACATGTGATGCCTACCACAT
GACCGAGCCTCACCCTGATGGAGCTGGTGTGATTATATGTATTGAGAGAGCGTTAGCTCATGCTGGGATTCCCAAGGAAC
AGATAAATTACGTCAATGCACATGCAACCTCAACACCAGCTGGAGACCTTAAGGAGTACAAAGCCCTGGTTCACTGTTTT
GGTCAAAATCCTGAGCTAAAGGTAAACTCCACGAAATCTATGATCGGACACTTGCTGGGAGCTGCTGGAGCTGTAGAGGC
TGTTGCAACCGTGCAGGCAATAAGAACCGGTTGGGTTCATCCAAATATCAACCTAGACAATCCAGAGAATGGAGTGGATA
CAAAATTGCTGGTGGGTTCTAAGAAGGAGAGATTGAACATTAAAGCAGCCTTGTCAAATTCTTTTGGGTTTGGTGGTCAT
AACTCCAGCATCATTTTTGCTCCTTACAAGTGA