Details for Chinese cabbage Locus Brara.B02144

Position : A02 ( 5`- 13470630 .. 13472174 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.B02144

Protein [Map View]
MSSSAEYREFSGRKLQKKPSFSQTCSRLSRYLKEKGSFGDLSLGMTCNPDVTGVFAVSRQPTMMNLFPCEEASPTQDVKP
THKVPRQSSFSSSSSAGAKGEVEKIIETKSVKVESQSAQLTIFYGGQVMVFDDFPAEKAKQVIDLANKGSDYAQNIAKNQ
KEIASTTPNPVPSLAKTAAAPELVQTNTSSLACELPIARRASLHRFLEKRKDRITSKAPYQIDGSTEASSRPDTSWLGSQ
*

DNA
ATGTCGAGTTCTGCCGAGTATCGGGAATTTTCTGGTCGGAAGTTACAGAAGAAGCCGAGCTTCTCACAGACATGTAGCCG
TTTGAGTCGTTATCTCAAGGAGAAGGGTAGCTTCGGAGATCTGAGCTTGGGGATGACATGCAACCCTGACGTCACTGGAG
TTTTTGCTGTGTCTCGACAACCAACGATGATGAATCTCTTCCCTTGTGAAGAAGCTTCCCCTACTCAAGACGTTAAACCA
ACGCATAAGGTTCCTCGGCAGTCAAGCTTTTCTTCTTCCTCTTCCGCTGGAGCCAAGGGAGAAGTCGAGAAGATCATAGA
GACTAAATCTGTGAAGGTGGAGTCTCAATCTGCTCAATTGACCATATTCTACGGTGGACAAGTTATGGTGTTTGATGATT
TTCCTGCGGAGAAAGCCAAACAAGTCATTGACTTGGCTAACAAAGGAAGTGATTATGCTCAAAACATAGCCAAGAACCAA
AAGGAGATTGCTTCTACTACCCCAAATCCAGTTCCTAGCCTTGCAAAAACTGCAGCAGCACCAGAGCTAGTCCAGACAAA
CACGTCTTCCTTAGCATGCGAACTTCCAATTGCTAGAAGAGCTTCGCTTCATCGATTCCTGGAGAAGAGAAAGGATAGGA
TTACATCAAAGGCACCGTACCAGATAGACGGTTCAACCGAAGCATCTTCCAGGCCTGACACATCTTGGCTAGGTTCTCAG
TAA