Details for Chinese cabbage Locus Brara.B02143

Position : A02 ( 5`- 13466576 .. 13469826 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.B02143

Protein [Map View]
MGSSTEEKVVAVILVGGPTKGTRFRPLSLNIPKPLFPIAGQPMVHHPISACKRIPNLAQVYLVGFYEEREFALYVSAISN
ELKVPVRYLREDKPHGSAGGLYHFRNLIMEDNPSHIFLLNCDVCCSFPLPEMLEAHRKYGGIGTLLVIKVSPESASQFGE
LVADPVTNELLHYTEKPETFVSDRINCGVYVFTPEIFTAIRDVSSQRNDTATLRRVSSYEALQPATRIPADFVRLDQDIL
SPLAGKKQLYTYETMDFWEQIKSPGMSLRCSELYLSQFRLTSPHMLASGDGTKSAIVIGDVYIHPSAKVHPTAKIGPNVS
ISANARVGPGVRLISCIILDDVEIMENAVVTNAIVGWKSSIGRWSRVQAEGVYNSKLGVTILGDSVAVEDEVVVTSSIVL
PNKTLNVSVQDEIIL*

DNA
ATGGGGAGCTCAACGGAGGAGAAAGTGGTGGCTGTGATCCTTGTCGGTGGTCCGACCAAAGGTACTCGATTCCGACCATT
GTCCCTGAATATTCCAAAGCCTCTGTTTCCCATTGCCGGACAACCAATGGTGCATCACCCTATCTCCGCTTGTAAAAGGA
TTCCAAACCTAGCTCAAGTTTATCTTGTTGGCTTCTATGAGGAAAGGGAGTTTGCACTTTACGTCTCTGCCATTTCCAAT
GAACTCAAAGTCCCTGTCAGATATCTGAGGGAAGACAAGCCACATGGTTCTGCTGGTGGGTTGTATCACTTTAGAAACCT
AATCATGGAAGATAACCCGTCTCATATCTTCCTACTTAACTGTGATGTTTGCTGCAGCTTCCCCTTGCCTGAGATGCTCG
AGGCTCATAGGAAATATGGTGGCATTGGAACTCTTCTAGTCATCAAGGTCTCTCCTGAATCAGCAAGCCAATTTGGAGAG
CTGGTTGCAGATCCAGTTACTAATGAGCTGCTTCATTACACCGAGAAACCAGAAACTTTTGTCAGTGACCGTATTAACTG
CGGTGTTTATGTATTCACACCTGAAATTTTCACTGCTATAAGAGATGTTTCCTCTCAAAGGAATGACACAGCGACTCTGA
GACGTGTTTCCAGCTATGAAGCTCTTCAACCAGCAACAAGGATCCCGGCAGATTTTGTTAGACTGGATCAAGACATCCTT
TCACCTTTAGCTGGGAAGAAACAGCTCTATACTTACGAGACTATGGATTTTTGGGAGCAGATTAAATCTCCTGGAATGTC
GCTGAGATGCTCGGAACTTTATCTATCCCAGTTCCGGTTAACCTCTCCCCACATGTTGGCTAGTGGTGATGGAACAAAGA
GTGCCATAGTGATTGGTGATGTTTACATACATCCTTCTGCAAAAGTACACCCAACTGCAAAGATTGGTCCCAACGTCTCA
ATCTCTGCAAATGCTCGTGTTGGACCCGGAGTCAGGCTTATCAGCTGTATCATCCTTGACGACGTTGAGATCATGGAGAA
TGCAGTGGTGACAAATGCTATCGTCGGTTGGAAATCTTCAATCGGGAGATGGTCCCGTGTCCAGGCTGAGGGAGTCTACA
ATTCCAAACTTGGAGTTACAATTCTCGGAGACTCGGTGGCAGTTGAAGACGAGGTTGTGGTGACCAGCAGTATTGTTCTT
CCAAACAAGACTCTTAACGTCAGTGTTCAAGATGAAATAATCTTGTAA