Details for Chinese cabbage Locus Brara.B02141

Position : A02 ( 5`- 13452919 .. 13454164 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.B02141

Protein [Map View]
MADGSNTVACGISKEIMLFGVRVVLDPMRKSVSLNNLSDYEQTDEILKIGGEDGDRQDKNKTNSCYASADEAGPVSSNRE
RKRGVPWSEEEHKLFLLGLEKVGKGNWKGISQNFVKSRTSTQVASHAQKYFLRRSNLNRRRRRRSSIFDMTTPMVMPMEE
VQENTSQPSSLVPEVNLVPFTLQASPEPISLSLSLALSNINEPSSSSRHSAFNTIGVA*

DNA
ATGGCCGACGGTAGTAACACGGTCGCGTGCGGCATAAGTAAAGAGATTATGCTGTTCGGTGTTAGGGTTGTGCTTGACCC
TATGAGAAAGAGCGTGAGTTTGAACAACTTGTCTGATTATGAGCAGACGGATGAGATCCTAAAGATCGGTGGCGAGGATG
GAGATAGACAAGATAAGAACAAAACCAACTCCTGTTACGCTTCCGCGGATGAAGCTGGTCCGGTTTCTTCTAATCGTGAG
AGGAAACGAGGAGTTCCATGGAGTGAGGAAGAGCACAAGCTGTTCTTGCTTGGTCTGGAGAAAGTAGGAAAAGGAAATTG
GAAAGGAATATCTCAAAACTTTGTCAAGAGCAGGACGTCTACTCAAGTAGCTAGTCATGCTCAGAAATACTTTCTCCGGC
GAAGTAATCTCAACCGTCGCCGCCGGAGAAGATCTAGTATTTTTGACATGACAACTCCTATGGTAATGCCCATGGAAGAA
GTGCAGGAGAACACATCACAACCATCTTCTCTTGTACCAGAAGTTAACCTGGTCCCATTTACTTTGCAAGCTAGTCCTGA
ACCGATCTCTCTCAGCCTCTCACTAGCCTTATCCAATATAAATGAGCCATCTTCTTCTTCAAGGCATTCAGCATTCAACA
CCATTGGAGTCGCTTAA