Details for Chinese cabbage Locus Brara.B02138

Position : A02 ( 5`- 13433167 .. 13437659 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.B02138

Protein [Map View]
MASLQLSSHFLGTNTKKHSSMSISRTYSPVPCTRLFSRKFMSCSMSMNGCEGDFKTPLGTVETRTMAAVLSPTSATESLI
SAVSELKSQPPPFSSGVVRLEVPINQQIGAIDWLQAQNETHPRCFFSRRSDVGRPDLLLDLASEKDNNNEGSSGRDLVSV
AGIGSAVFFRDLDPFSHDDWRSIRRFLSSTSPLIRAYGGMRFDPNGKISVEWKPFGAFYFAVPQVEFNEFGGSSMLAATL
AWDDELSWTLENAVESLQETMLQVSSIVMKLRKESLGVSVLSKNHVPTKGAYYPAVEKALEMINQKSSSLNKVVLARNSR
VITDTDIDPIAWLAQLQSEGHDAYQFCLQPPGAPAFIGNTPERLFQRKQLGVCSEALAATRPRGASTARDKEIEDDLRTS
LKDDLEFSIVRDNIQEKFNSICDNVVVKPQKSVRKLARVQHLYSQLAGRLRREDDEFDILAALHPTPAVCGLPAEEARLL
IKEIESFDRGMYAGPIGFFGGQESEFAVGIRSALVEKGLGALIYAGTGIVAGSNPTSEWNELDLKISQFTKSIEYKSTSL
QRIN*

DNA
ATGGCCTCACTTCAACTCTCCTCTCATTTTCTTGGCACAAACACTAAGAAACACAGCTCCATGTCCATCTCTCGTACTTA
CTCTCCTGTCCCATGCACCAGATTATTCTCCCGCAAGTTTATGTCGTGTTCCATGTCTATGAATGGATGCGAAGGTGATT
TCAAGACGCCACTTGGTACAGTTGAGACGAGGACTATGGCGGCAGTTTTATCTCCAACATCCGCCACTGAGAGTCTAATC
TCCGCCGTCTCTGAGCTTAAGTCTCAACCTCCGCCGTTTTCCTCCGGCGTCGTCCGCTTAGAGGTACCAATCAACCAGCA
AATCGGAGCAATCGATTGGCTCCAAGCGCAGAACGAGACTCATCCTCGCTGCTTCTTCTCTCGCCGTAGCGACGTTGGTC
GTCCTGATCTTCTTCTCGACTTAGCGAGCGAGAAGGATAACAATAACGAAGGCTCATCAGGTCGTGATCTGGTCAGCGTT
GCTGGTATCGGTTCAGCAGTGTTCTTTCGTGACCTTGACCCGTTCTCTCATGATGACTGGAGATCCATCAGAAGGTTTTT
GTCGTCTACGTCACCTTTGATTCGTGCCTATGGTGGCATGAGGTTTGATCCTAACGGCAAGATCTCTGTGGAGTGGAAAC
CCTTTGGTGCATTTTACTTTGCAGTGCCTCAGGTTGAGTTTAATGAGTTTGGGGGAAGCTCAATGTTGGCTGCAACTCTT
GCTTGGGACGATGAACTCTCTTGGACTTTGGAAAATGCCGTTGAATCACTTCAAGAGACTATGCTTCAGGTTTCTTCTAT
TGTGATGAAGTTGCGGAAGGAATCTCTAGGAGTATCTGTTCTTAGCAAGAACCATGTTCCTACAAAAGGAGCGTATTACC
CTGCCGTAGAGAAGGCTTTGGAGATGATAAATCAAAAGAGTTCATCCCTTAACAAGGTTGTGCTTGCTCGCAACAGCAGA
GTGATCACAGATACCGACATTGATCCCATCGCATGGCTTGCACAGTTACAGAGTGAAGGGCATGATGCGTATCAGTTCTG
TCTTCAGCCACCAGGTGCACCAGCTTTTATCGGAAACACGCCTGAGAGACTTTTCCAAAGGAAACAGTTAGGCGTCTGCA
GTGAAGCTCTGGCTGCAACTAGGCCTCGAGGTGCTTCAACGGCTCGCGATAAGGAGATAGAGGATGACTTGCGAACCAGC
CTAAAGGACGACCTTGAGTTTTCTATTGTACGAGATAATATACAAGAAAAATTTAACTCTATATGTGACAACGTAGTTGT
TAAGCCTCAAAAATCTGTGAGGAAGCTTGCAAGAGTGCAACACTTGTATTCTCAATTGGCTGGGAGGCTTAGGAGGGAAG
ATGATGAGTTTGACATATTGGCTGCTCTGCATCCAACTCCAGCTGTTTGTGGACTTCCAGCTGAAGAAGCCAGGCTTTTA
ATCAAGGAAATAGAATCATTCGATAGAGGAATGTATGCCGGACCTATTGGATTTTTTGGTGGTCAAGAGAGTGAATTTGC
AGTTGGGATCAGATCAGCTCTAGTTGAAAAGGGTCTTGGAGCATTGATCTATGCCGGGACAGGGATAGTAGCAGGAAGCA
ACCCAACCTCAGAGTGGAATGAACTTGATCTAAAGATATCTCAGTTTACCAAGTCAATTGAATATAAGTCAACAAGTCTA
CAGAGGATTAATTGA