Details for Chinese cabbage Locus Brara.B02135

Position : A02 ( 5`- 13417672 .. 13418415 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.B02135

Protein [Map View]
MAKLITYLLFITILFSFIFLTMSKETEYNPESYGAGSLKSYQCGGECTRRCSNTKYHKPCMFFCQKCCAKCLCVPPGTYG
NKQVCPCYNNWKTQQGGPKCP*

DNA
ATGGCAAAACTCATAACTTACCTTCTCTTTATCACCATTCTCTTCTCTTTCATCTTTCTCACTATGTCAAAAGAAACAGA
GTACAATCCAGAAAGTTATGGAGCTGGAAGTCTCAAATCATACCAATGTGGAGGGGAATGCACTAGGAGGTGCAGCAACA
CCAAGTACCATAAGCCATGCATGTTTTTCTGCCAAAAGTGTTGTGCTAAATGTCTTTGTGTCCCTCCAGGCACTTACGGC
AACAAACAAGTGTGTCCTTGTTACAACAACTGGAAGACTCAACAAGGTGGACCAAAATGTCCTTGA