Details for Chinese cabbage Locus Brara.B02134

Position : A02 ( 5`- 13393467 .. 13395401 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.B02134

Protein [Map View]
MGRPPCCGKMEVKKGPWTPEEDIILVSYIQQHGPGNWRSVPLNTGLLRCSKSCRLRWTNYLRPGIKRGNFTQPEEKTIIR
LQALLGNRWAAIASYLPQRTDNDIKNYWNIHLKKKLELKVQNGITNEDNTDMTEIPSCNIHNNSCNNNNNNKRVVNKGQW
EKKLQTDINMAKQALLQALSLDQPSSSIPPDPDSSKSHHSATSTYASSTDNIFKLLQNWTSSSSSIPNTSSHSMNRGLTT
GEVGVLDHQSLFSSHSESGSVDGKLNLMTETSMFKDGSEPNGDIEATTDAATDDHGSLSLIEQWLFDEQGICQCDDNQED
LIEVSFEGIDNDNNDQDLF*

DNA
ATGGGTAGACCACCTTGTTGCGGGAAGATGGAGGTGAAGAAAGGACCATGGACTCCTGAAGAAGATATAATCTTGGTCTC
TTATATCCAACAACATGGCCCTGGAAACTGGAGATCTGTTCCTTTAAACACCGGTTTGCTAAGGTGTAGCAAGAGTTGTA
GACTTAGATGGACTAATTACCTTCGTCCTGGAATTAAACGAGGAAATTTTACTCAGCCTGAGGAGAAAACGATCATCCGC
CTCCAAGCTCTTTTGGGGAATAGATGGGCAGCCATAGCATCATATCTACCACAGAGAACCGACAATGATATCAAGAACTA
TTGGAACATTCATCTTAAAAAGAAACTCGAGTTGAAGGTTCAAAATGGTATCACCAACGAAGATAACACCGATATGACAG
AGATTCCCTCTTGTAATATTCACAACAATAGCTGTAATAACAACAACAACAACAAAAGAGTCGTCAACAAAGGTCAATGG
GAGAAAAAGCTTCAAACAGACATAAACATGGCCAAACAAGCCTTACTCCAAGCATTATCACTTGACCAACCATCTTCATC
GATCCCTCCAGATCCCGACTCATCAAAAAGTCATCATTCTGCCACCTCTACTTATGCCTCAAGCACGGATAACATATTTA
AGTTACTACAGAACTGGACAAGCTCATCTTCTTCAATCCCTAACACTTCATCACACTCCATGAACCGGGGCTTAACCACC
GGTGAAGTAGGAGTTCTTGATCATCAGTCTTTGTTCTCATCGCACTCAGAATCTGGATCAGTTGATGGTAAGTTGAATTT
GATGACGGAGACAAGTATGTTCAAAGATGGAAGCGAACCAAACGGTGACATTGAAGCAACTACCGATGCTGCTACTGATG
ATCATGGCTCCTTGTCTTTGATCGAGCAATGGTTATTTGATGAACAAGGTATATGTCAGTGTGATGACAATCAAGAAGAT
CTGATTGAGGTTTCTTTTGAAGGTATAGATAATGATAACAACGATCAAGATTTGTTCTAA