Details for Chinese cabbage Locus Brara.B02133

Position : A02 ( 5`- 13371320 .. 13373724 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.B02133

Protein [Map View]
MAASAAFSVSSPPFVPSSCKIRRPFLLLGSKSFKPVSVRASVGNPSISIDDKASVQTKTSKWQWKFKGNSIGIHYEEHEG
EKSESAKNILMIPTISDVSTVEEWRSVARNIVQRDGEVNWRATIVDWPGLGYSDKLKMDYDTDVMERFVVDFMNSPESPM
SQAGNDDIVIIGGGHAATLAVRATQRGLLKPSAIAAVAPTWAGPLPIVFGRDSSMVTRYGLLRGTLRAPGVGWMMYNMLV
SNEKSIESQYKSHVYADQSNVTEAIIQSRYELTKQKGSRYVPAAFLTGLLDPVSSRDEFLQLFADLEGKLPVMVMSTKGA
PKRSKAEMEALRGAKGVSTFVEVEGALLPQEEYPSLVAQELYNFLQETYASSK*

DNA
ATGGCTGCTTCAGCTGCTTTCTCTGTATCTTCACCACCCTTCGTTCCCTCTTCCTGCAAAATTCGAAGACCGTTTCTCTT
GCTTGGTTCAAAAAGTTTCAAACCCGTTTCGGTGAGAGCTTCTGTCGGAAACCCCTCGATCTCCATCGATGACAAAGCTT
CAGTCCAAACTAAGACAAGCAAGTGGCAGTGGAAGTTCAAGGGAAACTCGATCGGTATCCACTATGAGGAGCATGAGGGA
GAGAAGAGTGAATCAGCGAAGAATATCCTCATGATACCAACGATATCAGATGTTAGCACCGTGGAGGAGTGGAGATCTGT
GGCTAGAAACATCGTGCAGCGTGACGGGGAAGTTAATTGGCGTGCAACTATTGTAGATTGGCCTGGTCTTGGTTACTCTG
ATAAACTTAAGATGGATTACGACACAGATGTCATGGAGAGGTTTGTGGTTGACTTCATGAACTCACCTGAGAGCCCAATG
AGCCAGGCAGGTAACGATGATATAGTAATCATTGGAGGAGGACATGCAGCAACACTGGCAGTACGTGCTACCCAACGTGG
GCTACTCAAACCATCAGCTATTGCTGCTGTTGCACCTACATGGGCTGGACCTCTCCCTATTGTGTTTGGCCGTGACTCTT
CCATGGTGACAAGGTATGGTCTCCTAAGAGGAACACTAAGAGCACCTGGTGTTGGTTGGATGATGTACAACATGCTAGTG
AGCAACGAGAAATCAATCGAGTCTCAATACAAATCCCATGTTTACGCAGATCAAAGCAACGTGACTGAGGCCATAATCCA
AAGCAGATACGAGTTAACAAAGCAGAAGGGATCACGCTACGTCCCTGCAGCTTTCTTAACCGGTTTGCTCGACCCGGTTT
CATCCAGGGATGAGTTTCTCCAGCTGTTTGCTGATTTGGAAGGGAAACTTCCGGTTATGGTGATGTCAACGAAAGGAGCT
CCAAAGAGATCAAAAGCTGAGATGGAGGCACTTAGAGGAGCCAAAGGAGTTAGCACATTTGTGGAGGTTGAAGGTGCACT
CTTGCCTCAAGAAGAGTATCCTTCTCTTGTTGCTCAAGAGCTCTACAACTTCTTGCAAGAGACCTATGCGTCTTCCAAGT
AA