Details for Chinese cabbage Locus Brara.B02131

Position : A02 ( 5`- 13367151 .. 13368067 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.B02131

Protein [Map View]
MEENKSKVTLHGMWASSYSKRVEIALKLKGILYEYVEEDLSNKTESLVRLNPVHKKVPLLVHDGKPVAESQVILEYIDET
WNNSPRLLPEDSYERAQVRFWVSYINQQVIEVMGKVLFQEGEAQEKAIEEARERFKVLEEGLKKHFPNKTIRENDDVGLL
DIIIISTFGSHKVYHDVFGVGVIDQVNTPTLYNWIESLKELAVMKEAEVPSDRLVPFLQMYRQMHLQQAANA*

DNA
ATGGAGGAAAACAAGAGCAAAGTGACACTACATGGGATGTGGGCAAGCTCATACTCAAAGAGAGTCGAAATCGCTCTTAA
ACTCAAGGGTATACTCTACGAGTACGTGGAAGAAGATCTAAGCAACAAGACGGAGTCGCTGGTTCGACTCAACCCTGTTC
ACAAGAAGGTTCCTCTTCTTGTCCATGATGGTAAACCAGTGGCTGAATCACAAGTGATTCTTGAATATATCGATGAAACG
TGGAACAACTCTCCTCGTCTCTTGCCAGAGGATTCTTATGAAAGGGCCCAGGTTCGGTTCTGGGTCAGCTACATCAACCA
ACAGGTGATTGAGGTCATGGGTAAAGTTCTGTTTCAAGAAGGTGAAGCTCAAGAAAAGGCTATAGAAGAGGCTAGAGAGA
GGTTCAAAGTTCTTGAAGAGGGACTAAAGAAGCATTTCCCAAATAAAACCATCAGAGAGAATGATGATGTAGGGCTTTTG
GACATCATCATCATCTCTACTTTTGGATCCCACAAAGTTTATCATGACGTGTTCGGTGTAGGGGTAATTGATCAAGTGAA
CACTCCAACATTATACAACTGGATAGAGAGCCTGAAAGAGCTGGCCGTGATGAAAGAAGCTGAAGTGCCTAGTGATAGGT
TGGTGCCCTTTCTCCAGATGTATAGACAAATGCATCTCCAGCAGGCTGCAAACGCCTAA