Details for Chinese cabbage Locus Brara.B02130

Position : A02 ( 5`- 13364195 .. 13365593 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.B02130

Protein [Map View]
MGSGVGSFLKVLLRNFDVLAGPVVSLVYPLHASVRAIETQSHADDKQWLTYWVLYSLLTLFELTFAKLIEWVPIWSYAKL
ILTCWLVIPYFSGAAYVYEHFVRPVFVNPQSINIWYVPKKMDFFRKPDDVLTAAEKYIAENGPDAFEKILSRADKSRRYI
KEHETMYGEEYQYEGNFKSY*

DNA
ATGGGATCTGGAGTTGGAAGTTTCCTCAAGGTTCTTTTGAGGAACTTCGATGTTCTTGCTGGGCCTGTTGTTAGTCTCGT
TTATCCACTACATGCCTCAGTGAGAGCCATTGAAACTCAATCTCACGCTGATGACAAACAGTGGCTCACTTACTGGGTCC
TTTACTCCTTACTCACACTCTTCGAGCTCACATTCGCCAAGCTCATCGAATGGGTACCGATTTGGTCATACGCCAAGCTG
ATCTTGACCTGCTGGCTTGTGATTCCTTACTTCAGCGGCGCTGCTTATGTCTATGAACACTTTGTCAGACCTGTGTTTGT
TAACCCACAGAGCATTAACATTTGGTATGTGCCAAAGAAGATGGATTTCTTCAGAAAGCCAGATGATGTGTTGACAGCTG
CTGAGAAGTACATTGCTGAGAATGGTCCTGATGCTTTCGAGAAGATCTTAAGCAGAGCCGATAAATCAAGAAGATATATT
AAAGAGCATGAGACAATGTATGGTGAGGAGTATCAGTATGAAGGGAACTTCAAAAGCTATTAA