Details for Chinese cabbage Locus Brara.B02128

Position : A02 ( 5`- 13346837 .. 13347206 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.B02128

Protein [Map View]
MSGRRSRSRQSSGTTRMSEDQINDLVIKLQQLLPELRDSHRSDKVSAARVLQDTCNYIRNLHREVDDLSERLSELLANSD
TAQAALLRSLLTQ*

DNA
ATGTCGGGAAGAAGATCACGTTCGAGGCAATCATCAGGAACTACAAGGATGTCAGAGGATCAGATCAACGATCTCGTAAT
CAAGTTGCAGCAGCTTCTTCCTGAGCTCAGGGACAGTCATCGTTCCGACAAGGTTTCAGCAGCAAGAGTGTTGCAAGATA
CATGCAACTACATAAGGAATCTGCATAGAGAGGTTGATGATCTCAGTGAGAGGCTATCTGAGTTACTCGCAAACTCAGAC
ACTGCTCAAGCCGCTTTACTCAGAAGCTTACTTACCCAATAA