Details for Chinese cabbage Locus Brara.B02127

Position : A02 ( 5`- 13340211 .. 13341201 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.B02127

Protein [Map View]
MADHTLNEENPFSVLTHSLSFDDHSLLTYPSFEWEEEHLFMNNSVYEAFPLPTPLPDLEPLSQDVLESYSSASLNVTDQN
RGQGDLEQNTEEEAVQETTNKRKINRYVTTYTTFSTSKALSMETISLYFYMPITQAATELDVGLTLLKRRCRELGFTRWP
HRKLMSLLALISNVKLQKFEGGENAEKLKNALLEMLENQKRRIEENPDLEFDDKTKRLRQACFKATHKMKKKASLKSDHL
CGFAKEFN*

DNA
ATGGCTGATCATACACTCAACGAAGAGAACCCGTTCTCAGTTCTAACCCATTCACTTTCCTTTGATGATCACAGCTTGTT
AACGTATCCTTCATTTGAATGGGAAGAAGAGCATCTTTTTATGAACAACTCTGTCTATGAAGCTTTTCCTTTGCCTACAC
CTTTACCTGACCTTGAACCCTTGTCTCAAGATGTACTCGAGTCATATAGCTCTGCATCATTGAACGTAACAGACCAGAAC
AGAGGACAAGGTGACTTGGAGCAGAATACTGAAGAAGAAGCAGTGCAAGAGACGACTAATAAGAGGAAAATTAACAGATA
TGTTACTACCTACACAACCTTTTCAACTTCAAAGGCGTTGTCCATGGAAACTATATCTCTATACTTCTACATGCCAATAA
CTCAGGCAGCTACTGAACTCGACGTTGGTTTAACTCTTCTAAAAAGAAGATGTCGCGAGCTAGGCTTTACTCGGTGGCCT
CATCGCAAACTCATGAGCCTACTAGCTCTGATTAGTAACGTCAAGCTGCAGAAGTTTGAAGGAGGAGAGAATGCAGAAAA
ACTCAAGAACGCACTGCTGGAGATGCTAGAGAATCAGAAGAGGAGGATTGAAGAGAATCCGGATTTGGAGTTTGATGACA
AGACAAAGAGGCTAAGACAAGCTTGTTTCAAGGCTACACACAAGATGAAGAAGAAGGCAAGTCTCAAGTCTGACCACTTG
TGTGGTTTCGCAAAAGAGTTTAATTAG