Details for Chinese cabbage Locus Brara.B02126

Position : A02 ( 5`- 13338179 .. 13340204 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.B02126

Protein [Map View]
MASFTLKSFTGLRQSSTEQTNFISNVPSSLSLPQRRTSLRVTASRASPNLANRKLRVAVIGGGPAGGAAAETLAQGGIET
ILIERKMDNCKPCGGAIPLCMVGEFNLPLDIIDRRVTKMKMISPSNIAVDIGRTLKEHEYIGMVRREVLDQYLRERAEKS
GATVINGLFLKIDLPENWDTPYVLHYTEYDGKTGATGQKKTMEVDAVIGADGANSRVAKSIGAGDYDYAIAFQERIRIPD
DKMTYYEDLAEMYVGDDVSPDFYGWVFPKCDHVAVGTGTVTHKGDIKKFQLATRNRAKDKILGGKIIRVEAHPIPEHPRP
RRLSKRVALVGDAAGYVTKCSGEGIYFAAKSGRMCAEAIVEGSQNGKKMIDESDLRKYLEKWDKTYLPTYRVLDVLQKVF
YRSNPAREAFVEMCGDEYVQKMTFDSYLYKRVAPGSPLEDLKLAVNTIGSVFRANALRREIEKLNV*

DNA
ATGGCGAGTTTCACACTCAAATCCTTCACCGGACTCCGTCAATCCTCAACGGAGCAAACCAACTTCATCTCCAATGTCCC
GTCGTCACTCTCTCTCCCCCAGCGACGAACCTCTCTCCGCGTAACCGCCTCCAGAGCCTCTCCCAACCTCGCTAACCGCA
AACTCCGCGTCGCCGTCATCGGTGGAGGTCCGGCGGGAGGAGCCGCCGCCGAAACTCTCGCTCAGGGAGGCATCGAGACG
ATCCTCATCGAGCGTAAGATGGACAACTGCAAGCCTTGCGGCGGCGCGATCCCTCTCTGCATGGTCGGCGAATTCAACTT
GCCTCTCGACATCATCGACCGGAGGGTCACCAAGATGAAGATGATTTCTCCTTCGAACATCGCCGTGGACATCGGCCGTA
CGCTTAAGGAGCATGAGTATATAGGTATGGTGAGGAGAGAGGTTCTTGACCAGTACCTGAGGGAGAGAGCGGAGAAGAGT
GGAGCCACCGTTATCAACGGTCTCTTCCTTAAGATTGACTTGCCGGAGAATTGGGACACGCCGTACGTGTTGCATTACAC
GGAGTACGACGGGAAAACAGGAGCTACGGGACAGAAGAAGACCATGGAGGTTGACGCTGTTATCGGAGCTGACGGAGCTA
ACTCTAGAGTTGCGAAGTCCATCGGCGCCGGAGATTACGACTACGCCATCGCGTTTCAGGAGAGAATTAGAATTCCAGAT
GATAAGATGACGTACTATGAGGATCTAGCTGAGATGTACGTCGGAGATGACGTGTCTCCGGATTTTTACGGATGGGTTTT
CCCGAAATGCGACCATGTAGCTGTCGGAACAGGTACTGTTACTCACAAAGGTGACATCAAGAAGTTCCAGCTCGCGACTA
GGAACAGGGCCAAGGACAAGATTCTAGGAGGAAAGATCATCCGCGTGGAGGCTCACCCTATACCGGAACACCCGCGTCCA
CGTAGGCTCTCCAAGCGTGTGGCTCTTGTTGGTGATGCTGCAGGGTACGTGACGAAATGTTCTGGTGAAGGGATCTATTT
CGCTGCAAAGAGTGGGAGAATGTGCGCTGAAGCTATCGTTGAAGGCTCACAGAATGGCAAGAAGATGATTGATGAGAGTG
ACTTGAGGAAGTACTTGGAGAAATGGGACAAGACATACTTGCCTACTTACAGGGTTCTTGACGTGTTGCAGAAAGTGTTT
TACAGATCTAATCCTGCTAGAGAAGCGTTTGTGGAGATGTGTGGTGATGAGTATGTTCAGAAGATGACGTTTGATAGTTA
TCTTTACAAGAGAGTTGCTCCGGGTAGTCCTTTGGAGGATTTGAAGTTGGCTGTGAACACTATTGGGAGTGTGTTTAGAG
CTAATGCTTTAAGGAGAGAGATTGAGAAGCTGAATGTTTAA