Details for Chinese cabbage Locus Brara.B02125

Position : A02 ( 5`- 13333906 .. 13335769 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.B02125

Protein [Map View]
MKYLLVFFIVLGLNAINGYDCKIVQFIFGDSLSDVGNNRNLPRSLAQANLPFYGIDFGNGLPNGRFTNGRTVSDIISDKI
GLPRPLAFLDPSMNEDVILANGVNYASGGGGILNETGGYFIQKFSLWKQIELFQGTQDVIVAKIGKKEAEKFFQQAGYVV
SLGSNDFINNYLMPVYSDSWKYTDQTFVDYLMETLESQLRVLHSLGARKLMVFGLGPMGCIPLQRALSLDGKCQNKASSL
AVRFNKAATTMLKDLETKLPNANYKFGEAYNLVNDVITNPQKYGFDNSDSPCCSFYRIRPALTCIPASTLYKDRSKYVFW
DEYHPTDKANELVANILIKRFDFMRADDGTSEAPSPSPDLAPSPDDK*

DNA
ATGAAGTACTTACTCGTTTTTTTTATCGTTCTTGGACTCAACGCGATCAATGGCTACGATTGCAAGATCGTCCAGTTTAT
ATTTGGAGATTCATTGTCCGATGTAGGTAACAATAGAAACCTACCGAGGAGTTTAGCTCAAGCGAATCTTCCCTTTTACG
GTATAGATTTTGGCAACGGTTTGCCTAATGGAAGGTTCACTAATGGCCGAACTGTTTCAGACATTATAAGTGATAAAATT
GGGTTACCAAGACCATTAGCCTTTCTAGATCCATCAATGAATGAAGATGTAATACTTGCAAATGGAGTGAACTACGCCTC
AGGAGGTGGTGGAATCTTGAATGAAACTGGTGGTTATTTCATCCAAAAATTTTCTCTATGGAAGCAAATAGAATTGTTCC
AAGGGACACAAGATGTAATTGTGGCAAAGATAGGGAAAAAAGAAGCAGAGAAATTCTTCCAACAAGCTGGATACGTCGTC
TCTTTAGGCAGCAATGACTTCATTAACAACTACTTGATGCCTGTCTATAGCGATTCTTGGAAGTACACTGATCAAACATT
CGTCGACTACTTAATGGAAACACTTGAATCTCAACTTAGGGTGTTGCATAGTTTGGGAGCGAGGAAGCTAATGGTGTTTG
GGTTAGGACCAATGGGTTGTATCCCACTCCAAAGAGCTTTAAGTCTCGATGGTAAATGTCAAAACAAAGCGAGTAGTCTT
GCTGTGAGATTCAACAAAGCTGCCACCACAATGCTTAAAGATCTTGAAACCAAGCTCCCAAATGCAAACTACAAGTTTGG
TGAAGCTTATAACCTCGTCAACGATGTTATCACTAACCCACAAAAATACGGATTCGACAACTCGGATTCGCCGTGTTGCT
CGTTCTACAGAATCAGGCCGGCGCTGACGTGTATTCCGGCGTCGACATTGTATAAAGACAGAAGTAAGTATGTGTTTTGG
GATGAGTATCATCCCACCGATAAGGCCAACGAGCTCGTTGCTAATATTCTTATCAAGAGGTTTGACTTCATGCGTGCTGA
TGACGGTACCTCCGAGGCTCCTTCTCCGTCCCCGGATCTAGCTCCTTCTCCCGATGATAAATAA