Details for Chinese cabbage Locus Brara.B02124

Position : A02 ( 5`- 13321641 .. 13322965 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.B02124

Protein [Map View]
MGRTTWFDVDGIKRGEWTAEEDRMLIAYINKYGVRDWGALPKRAGLHRCGKSCRLRWLNYLKPGIKKGKFTPQEEDDIIK
FHSLLGNRWAAIAKQMPNRTDNDIKNHWNSCLKKRLRRSGIDPMTHEPIKATSSSTRLSPARRHSSSTTSFSLSSTGSVR
LLNKLAAGISSRKLALDRIRTVMISSEPREVDEEEKTMISSRKEEEKVIGCFMEIDKNLISTMSLDELA

DNA
ATGGGGAGGACAACATGGTTCGACGTCGACGGGATAAAGAGAGGAGAATGGACGGCGGAGGAAGACCGGATGCTCATCGC
TTATATCAACAAATACGGTGTCAGGGACTGGGGTGCCCTGCCTAAGAGAGCCGGTCTGCATAGATGTGGAAAGAGTTGTA
GATTAAGGTGGCTGAATTATTTGAAGCCTGGTATTAAAAAAGGCAAGTTCACTCCTCAGGAGGAAGATGATATCATCAAA
TTTCACTCCCTTCTTGGAAACAGGTGGGCAGCAATAGCAAAGCAAATGCCAAACCGAACAGACAATGATATCAAGAATCA
TTGGAACTCATGTCTTAAGAAAAGACTTCGCAGAAGTGGGATAGATCCGATGACCCATGAGCCAATCAAAGCCACTTCCT
CCTCAACGAGGTTGTCTCCAGCACGGAGACATTCTTCTTCTACTACTTCTTTCTCTCTTTCCTCCACAGGCTCTGTACGT
CTACTTAACAAGCTTGCTGCTGGAATATCCTCGAGGAAACTTGCACTCGATAGGATCAGGACTGTGATGATATCTTCGGA
ACCAAGAGAAGTCGATGAAGAAGAGAAGACGATGATAAGCAGCAGGAAAGAAGAGGAGAAAGTGATTGGTTGTTTCATGG
AGATTGATAAGAATCTGATCAGTACGATGTCGTTAGATGAGTTGGCT