Details for Chinese cabbage Locus Brara.B02120

Position : A02 ( 5`- 13293211 .. 13294724 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.B02120

Protein [Map View]
MELADRAVGLLLSSISLSIFTYYTFWVIILPFVDSDHFIHKYFLPQDYAILVPVFAGVTLLSLLSVFIGMVILKSKKKKA
*

DNA
ATGGAGTTAGCGGATCGAGCAGTGGGGCTTCTGCTTTCATCAATCAGCTTATCCATATTCACCTACTATACTTTCTGGGT
CATCATCCTCCCATTTGTAGATAGTGATCACTTCATCCACAAGTACTTCTTGCCCCAAGACTATGCCATTCTCGTACCTG
TCTTTGCTGGCGTTACTCTCCTCTCTCTTCTTTCCGTGTTCATCGGCATGGTCATCCTCAAATCCAAAAAGAAGAAGGCT
TGA