Details for Chinese cabbage Locus Brara.B02119

Position : A02 ( 5`- 13285978 .. 13287041 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.B02119

Protein [Map View]
MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLIQIEGVNTTEEVTWYKGKRMAYIYKAKTKKNGSHYRCIWGKVTRPH
GNSGVVRAKFTSNLPPKSMGMRVRVFMYPSNI*

DNA
ATGGTGAAGGGACGCCAAGGAGAACGTGTCAGACTCTACGTCAGGGGAACCATCTTGGGATACAAAAGGTCGAAGTCAAA
CCAGTACCCAAACACATCCCTAATCCAGATCGAAGGAGTCAACACCACAGAGGAGGTGACATGGTACAAAGGAAAGAGGA
TGGCTTACATCTACAAGGCTAAGACCAAGAAGAACGGTAGCCACTACCGCTGCATCTGGGGAAAGGTTACAAGGCCTCAT
GGTAACAGCGGTGTTGTCCGTGCCAAATTCACTTCCAACTTGCCTCCTAAGTCCATGGGAATGAGGGTCAGAGTCTTCAT
GTATCCGAGCAACATTTGA