Details for Chinese cabbage Locus Brara.B02118

Position : A02 ( 5`- 13281948 .. 13284403 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.B02118

Protein [Map View]
MASSSRTEKRCLYEILDVNKESSPEEIRSSYRRLALQRHPDKLIKAGGISEADATAQFQELVHAYEVLSDPKERAWYDSH
RSQILFADQGSAGGSKSGGMPGGSVPDLFAFFSTSVYSGYSDTGKGFYKVYFDVFNSVYLNEIKFARTLGLSMDSVREAP
IMGNLESPYSQVTAFYNYWLGFSTVMDFCWVDEYDTMAGPNRRMRRKMEEENKKVRKKAKREYNETVRGLAAFVKKRDKR
VVDMMVKKSAEMELKKAEERERKKRMEKERLERAMSYEEPDWAKAQDEEEEEVEEDGGDDGKKKSEQLYCIVCSKKFKSE
KQWKNHEQSKKHKEKVAELRETFSDVEEEEEEIDEIPETVEDLEGLNMEEEDIEEEVVGEAEETEDEYFMAEEDVKGSSE
SEDEDVDDDELFLLKKMVEKNKRKNVVSREEDEVQVEIESDGEFDNQKSTTGRNRKGKKERNKLNAGKDITDDANKTQIA
MDDGNNSDDNVNASDSASGTVEESQKDETDPMEYDNRKSTGRRRRSKKGKDKSSEADDTTQKVMEETRSETLEDRSEYIE
HKKAPRSKKSTRGMKSKGTSKKASNNECDRCGEEFESRSKLFKHIADTGHATLKSR*

DNA
ATGGCGTCTTCTTCTCGCACGGAGAAACGATGCCTCTACGAAATTCTCGATGTAAACAAAGAATCTTCGCCGGAAGAGAT
CCGATCTTCCTACCGGCGTTTAGCCCTCCAGCGTCATCCCGACAAGCTCATCAAGGCCGGCGGAATATCGGAGGCTGACG
CCACCGCTCAGTTCCAAGAACTCGTCCACGCCTACGAGGTTCTATCCGATCCCAAGGAGCGAGCCTGGTATGACTCCCAC
CGATCTCAGATCCTATTCGCCGACCAAGGCTCCGCCGGCGGCTCTAAATCCGGCGGAATGCCTGGCGGCTCGGTTCCGGA
TCTATTCGCGTTCTTCTCCACCTCTGTTTACTCCGGTTACTCAGACACCGGTAAGGGATTCTACAAGGTGTACTTCGATG
TGTTCAACAGTGTTTACCTCAACGAGATTAAGTTCGCGAGAACGTTAGGGTTGAGTATGGACTCCGTGAGGGAGGCTCCC
ATCATGGGGAATCTAGAGAGTCCTTATTCTCAGGTGACGGCGTTTTACAACTACTGGTTAGGGTTCAGCACTGTTATGGA
TTTCTGCTGGGTGGATGAGTACGATACCATGGCGGGACCTAACCGGAGGATGAGGAGGAAGATGGAGGAGGAGAATAAGA
AGGTGAGGAAGAAGGCGAAGAGGGAGTATAACGAGACGGTGAGGGGGTTGGCTGCTTTTGTGAAGAAGAGGGATAAGAGA
GTGGTTGATATGATGGTGAAGAAGAGTGCGGAGATGGAGTTGAAGAAGGCGGAGGAGAGGGAGAGGAAGAAGAGGATGGA
GAAGGAGAGGTTGGAGAGGGCTATGAGCTATGAGGAGCCTGATTGGGCAAAGGCTCAGGATGAAGAGGAGGAAGAAGTGG
AAGAGGATGGTGGTGATGATGGTAAGAAGAAGAGTGAGCAGCTTTATTGCATTGTGTGTAGCAAGAAGTTTAAAAGTGAG
AAGCAGTGGAAAAACCATGAGCAGTCGAAGAAGCATAAGGAGAAAGTGGCGGAGTTGAGAGAGACATTCAGTGATGTAGA
AGAGGAGGAGGAAGAGATTGATGAGATACCTGAAACTGTAGAGGATCTCGAGGGGTTAAATATGGAAGAAGAGGATATTG
AGGAGGAGGTTGTAGGCGAAGCTGAGGAAACTGAAGATGAGTATTTTATGGCAGAGGAGGATGTGAAGGGATCTAGTGAA
AGTGAGGATGAGGATGTCGATGATGACGAGCTGTTTCTACTCAAGAAAATGGTGGAAAAGAATAAGCGAAAAAACGTTGT
GTCAAGAGAAGAAGATGAAGTTCAAGTTGAGATTGAGAGCGACGGCGAATTTGATAACCAGAAGAGCACAACGGGTAGGA
ACAGGAAAGGTAAGAAGGAGAGAAACAAACTGAATGCTGGAAAAGACATTACGGATGATGCCAACAAAACACAGATTGCT
ATGGACGACGGTAATAATTCAGATGACAATGTGAATGCAAGTGACTCAGCTTCGGGAACCGTTGAGGAGTCTCAGAAGGA
TGAGACGGATCCAATGGAGTATGATAACAGGAAGAGCACAGGGAGGAGACGCAGAAGTAAGAAGGGTAAGGACAAAAGCA
GTGAAGCTGATGATACTACTCAAAAAGTCATGGAAGAGACTCGTTCAGAAACGTTGGAGGATCGAAGTGAATATATAGAA
CACAAGAAGGCTCCAAGGTCAAAGAAATCAACCAGAGGAATGAAGTCCAAGGGCACATCGAAGAAAGCCAGTAATAACGA
ATGCGACAGATGCGGAGAGGAGTTTGAGTCGAGGTCGAAACTATTCAAGCATATAGCAGATACAGGTCATGCAACACTGA
AATCACGATGA