Details for Chinese cabbage Locus Brara.B02117

Position : A02 ( 5`- 13277668 .. 13280130 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.B02117

Protein [Map View]
MAFLSKVGRIFRQTSAHVTASNSMLQSIRCMSSSKIFVGGISYSTDEFGLREAFSKYGEVVDAKIIVDRETGRSRGFAFV
TFTSTEEASNAMELDGQDLHGRRIRVNYATERGSGFGGRGFGGPGGGYGAPAGGYGGGGGGGYGTPSGGYGGGSSYGGNA
GGGGYGGNSAYGGNAGGDGYGSNFGVAGGVGGSDNFAQGSSSSAGFDDKFSSDVPLGNDTDHQLESGEQFGGSDNQFGDS
ENRQTEVGPDGFDQTDDGDVAKRA*

DNA
ATGGCTTTCTTAAGTAAAGTTGGAAGGATATTTAGGCAGACTAGCGCCCATGTCACTGCCTCTAACTCAATGCTACAGAG
CATCCGTTGCATGTCTTCCTCAAAAATCTTTGTTGGAGGTATCTCCTACAGCACTGACGAGTTTGGCTTGAGAGAAGCTT
TTAGCAAATATGGAGAAGTTGTTGATGCCAAAATTATTGTGGACCGTGAAACTGGTAGATCAAGGGGTTTTGCTTTCGTA
ACGTTTACTTCAACCGAGGAGGCTAGTAATGCCATGGAATTGGATGGACAGGACCTTCATGGTCGAAGAATAAGGGTGAA
CTACGCTACTGAAAGAGGAAGTGGATTTGGAGGAAGGGGATTCGGTGGTCCTGGTGGTGGCTATGGGGCTCCAGCTGGTG
GTTATGGAGGCGGTGGTGGTGGTGGTTACGGTACTCCATCTGGTGGTTACGGAGGTGGCTCTTCTTATGGTGGAAATGCT
GGTGGTGGTGGTTATGGAGGTAACTCTGCATATGGTGGCAATGCCGGTGGTGATGGTTATGGAAGCAACTTTGGTGTCGC
CGGTGGTGTTGGTGGAAGTGACAACTTTGCACAAGGCAGCTCTTCTAGTGCTGGCTTTGATGACAAGTTTAGCAGCGACG
TACCACTAGGCAATGATACGGACCATCAGCTTGAAAGCGGTGAACAGTTTGGTGGCAGTGACAATCAATTTGGTGACTCA
GAGAACCGTCAAACAGAGGTTGGCCCAGATGGGTTTGATCAGACTGACGATGGTGATGTTGCCAAGAGAGCTTAA