Details for Chinese cabbage Locus Brara.B02109

Position : A02 ( 5`- 13226547 .. 13231662 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.B02109

Protein [Map View]
MAAKLLHSLADDSADLQKQIGCMNGIFQIFDRHHVLTGRRKSLTLGSGNANSINIERDSVDTFYQAKDTFQDTNIGVNVK
EKQRVSTESSRVSFSSSCSSSPSSPELIRGVQPEASAYDQANFPESPTSDSEMAEGNGFSQLGFDLRDVVRDSMYRDARG
LSLKTPMTREEVVRRSRREDSPRPYGLKQSTPADLSESFRFLAKLRKSPHHYNEVGAKGAPARYSVDSHDTLKSRQKLKE
LPRLSLDSRERVVQNSVVDLKPVKLPESSSSSNKKRPPSVVAKLMGLETLPGSPVGRDIHKLGLNNTFDDNNDPFSRSLR
EKNLNRTIRFSPSSPRSLGKDPSSPRWRNSDFVMKPLSSSRFPIEPAPWKQADRNRVLQKQPVKAAAPPEVAKFPPTVYS
EMERRLNDLEFKDSGKDLRALKQILEAMQSKVLLDTEKQPQSSNMAAQRDYATSNQETTSRTRVPSSSSNQVYQSPIVIM
KPAKLVEKAGIPASSLIPIHSLSGGLNKIRREKPDDKGASTSSKRVTKDSSSGKGRAESSLSSVDKKPNSRNVPSSSKKP
HKVTKESGTSKSSGSVSPRLQQKKLEHDKRSRPPTPPSDSTKSRKPLNRQMAESTSPGGRRRPKAQKSLQQSDDLVSQGS
NESRTSSHDMCTHSEAEAATVIEQASVMEAAKAVVSNLMHNKSSPRFSEDGSSANLSLVALEHPSPISVLDTSIYREMEP
SPVKTQGYVVAHDSGDDEQCEDQWNPAYSFSETTSTFSPEINRKKLQNVEHLVQKLRRLNSTHDEANQDYIASLCETSDP
NTDHRYISEILLASGLLLRDLGSGLTTFQLHPSGHPINPELFYVLEQTKGSSNTHLLLHKEESKALNKEKLNRKLVFDTV
NELLVEKLASVEATTNPLMKSSAKKAMSAQQLLKELCTEIESLQRQATKRSENFLLEEEDDFLKSILAEDVMIRSGNWVD
FSGEFSGLVLDVERLIFKDLVSEIVHAETSRLQAKSGRRRTLFSGQ*

DNA
ATGGCTGCAAAGCTTCTGCATTCGTTGGCAGATGATAGTGCAGATCTGCAGAAGCAAATTGGATGTATGAATGGTATTTT
TCAGATCTTTGACCGTCACCATGTTCTCACCGGCCGGCGAAAGAGTCTTACTTTAGGTAGTGGAAATGCAAATAGCATCA
ACATTGAGAGAGACTCTGTTGATACATTTTATCAAGCAAAAGACACTTTTCAGGACACAAACATTGGTGTGAATGTGAAA
GAGAAGCAAAGGGTTTCAACAGAATCATCAAGGGTTTCTTTTTCATCTTCCTGTTCGTCTTCTCCATCATCTCCGGAGTT
GATTAGAGGAGTCCAACCTGAAGCTTCTGCCTATGACCAAGCCAATTTTCCTGAATCTCCTACAAGTGATTCTGAGATGG
CCGAAGGGAATGGGTTTTCACAGCTAGGATTTGACCTCAGAGATGTTGTGAGAGACTCTATGTACAGAGACGCAAGAGGG
CTTTCGCTCAAGACTCCTATGACTAGAGAGGAAGTAGTAAGGCGCAGCAGAAGAGAGGACTCTCCACGGCCTTATGGTTT
GAAGCAATCCACACCTGCTGATCTCAGTGAGTCCTTCAGGTTTCTAGCCAAGCTTAGAAAATCACCACATCATTATAATG
AGGTTGGAGCAAAGGGTGCACCAGCACGTTACTCTGTTGATTCTCATGATACGCTGAAATCAAGACAGAAGTTGAAAGAG
CTGCCTAGGCTTTCGCTGGATAGCAGAGAAAGAGTGGTGCAAAACTCTGTTGTTGATCTTAAACCAGTTAAGCTTCCTGA
AAGTTCTTCAAGCAGCAACAAGAAACGGCCTCCAAGTGTTGTTGCAAAGCTCATGGGTTTGGAGACACTGCCAGGTTCAC
CAGTGGGTAGAGACATCCATAAGCTTGGTTTGAACAACACTTTTGACGATAACAACGATCCATTCTCAAGATCATTGAGG
GAGAAAAACCTGAACCGTACAATAAGGTTTTCTCCTAGCTCACCAAGAAGCTTGGGGAAGGACCCTTCTTCTCCAAGATG
GAGAAACTCTGATTTTGTTATGAAACCTCTGTCAAGTTCAAGGTTTCCCATTGAGCCAGCTCCGTGGAAGCAAGCTGATA
GAAACAGAGTTCTTCAGAAGCAACCTGTGAAGGCAGCAGCACCGCCTGAAGTGGCTAAGTTTCCTCCTACTGTGTACAGT
GAAATGGAGAGGAGATTGAACGATCTTGAGTTCAAAGATTCAGGAAAAGATCTTCGAGCTCTTAAACAAATATTAGAGGC
TATGCAGTCAAAGGTTTTGCTGGACACTGAGAAACAACCACAATCCTCAAACATGGCAGCTCAAAGAGATTATGCAACTT
CTAACCAAGAGACGACATCAAGAACTAGAGTTCCCTCATCTTCATCTAACCAGGTGTATCAATCTCCGATTGTGATTATG
AAACCTGCCAAACTCGTTGAGAAGGCTGGTATCCCTGCGTCATCTCTTATTCCAATTCACAGTCTATCTGGTGGGCTTAA
TAAGATCCGTAGAGAGAAGCCTGATGATAAAGGAGCTTCAACAAGTAGTAAACGGGTGACAAAAGACAGTAGTTCTGGAA
AGGGAAGAGCTGAATCATCTCTCAGTTCTGTTGATAAGAAACCTAACAGCAGAAACGTGCCGTCTTCTTCAAAGAAACCT
CATAAGGTTACCAAAGAAAGTGGTACTTCAAAGAGTTCAGGATCTGTAAGTCCAAGGTTGCAGCAGAAGAAGCTTGAGCA
TGACAAACGCTCACGGCCACCGACTCCTCCATCTGATTCTACTAAATCAAGGAAACCGTTAAACCGACAAATGGCAGAGT
CTACTTCTCCTGGTGGCAGACGTAGACCCAAGGCTCAGAAGAGTTTGCAGCAAAGTGATGACCTAGTTAGTCAAGGGAGC
AATGAGTCTAGGACGTCGAGTCATGACATGTGTACTCATTCTGAAGCAGAAGCTGCCACTGTTATAGAACAAGCATCTGT
AATGGAGGCAGCCAAAGCTGTAGTCTCCAACTTAATGCATAATAAATCCAGTCCAAGGTTTAGTGAAGATGGATCTTCAG
CAAACCTTTCACTAGTTGCTTTGGAGCATCCAAGTCCTATTTCAGTTCTTGACACCTCAATTTACAGAGAGATGGAACCA
TCTCCTGTGAAGACACAAGGTTATGTTGTTGCTCATGACTCTGGTGATGATGAACAATGTGAGGATCAGTGGAATCCAGC
ATACAGTTTCTCTGAAACAACATCAACCTTTTCGCCAGAGATAAACAGGAAGAAGCTTCAGAACGTTGAGCACTTGGTTC
AAAAGCTCAGACGGCTAAATTCTACCCATGATGAAGCCAACCAAGACTACATTGCTTCCCTCTGCGAGACCTCAGACCCC
AATACCGATCACAGATACATCTCCGAGATTCTATTAGCCTCAGGTCTTCTCCTCCGTGATCTCGGCTCAGGGTTAACAAC
GTTTCAACTACACCCTTCAGGCCACCCGATCAACCCAGAGCTGTTCTATGTTCTTGAGCAGACAAAGGGAAGCAGCAACA
CGCATCTGCTGCTACACAAAGAAGAAAGCAAGGCTCTGAACAAGGAGAAGCTCAACCGCAAACTTGTTTTTGACACGGTT
AATGAACTTCTTGTGGAGAAGCTAGCATCGGTTGAAGCCACAACGAATCCTTTGATGAAGTCATCTGCTAAGAAAGCCAT
GAGTGCGCAACAGCTATTGAAAGAACTGTGTACAGAGATAGAATCACTGCAAAGACAAGCCACAAAGAGATCAGAAAACT
TCTTGTTGGAGGAAGAAGATGATTTCCTGAAGAGTATACTTGCAGAAGATGTGATGATTCGGTCAGGGAACTGGGTGGAC
TTCAGTGGAGAGTTCTCAGGATTGGTGCTGGATGTGGAGAGGCTTATTTTCAAGGATCTGGTGAGTGAGATCGTGCATGC
AGAAACTAGCCGTTTGCAAGCAAAGTCAGGAAGACGAAGAACACTTTTCTCAGGCCAGTAA