Details for Chinese cabbage Locus Brara.B02107

Position : A02 ( 5`- 13205031 .. 13206050 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.B02107

Protein [Map View]
MEPTTTQNGSELELELSEFEKTQKKYQDFIASLPKSKGWRPKEILIQHGGHWWQECLLEGLLHAKDHFQARPTDFLVCSY
PKTGTTWLKALTYAIVNRSRFDDATNPLLKRNPHEFVPYVEIDFAFYPTVDVLQDQKNPLFSTHIPNGSLPDSIVNSGCK
MVYIWRDPKDTFISMWTFLHKEKSQEGQLASLEESFDMFCKGLSVYGPYLDHVLGYWKAYQENPERILFLRYETMRANPL
PFVKRLAEFMGYGFSAEEEEKGVAENVVKLCSFETLKNLEANKGDKEREDRPAVYANSAYFRKGKVGDWANYLTPEMAAR
IDGLVEEKFRDTGLLEHDQ*

DNA
ATGGAACCAACCACGACCCAGAACGGATCCGAACTCGAACTCGAACTCTCGGAGTTCGAGAAGACCCAGAAGAAGTACCA
AGACTTCATCGCTTCCCTCCCAAAGAGCAAAGGCTGGAGACCCAAAGAGATCCTCATCCAACACGGCGGACACTGGTGGC
AAGAATGTCTCCTCGAAGGCCTCCTCCACGCCAAAGACCACTTCCAAGCCCGACCCACCGACTTCCTCGTCTGCAGCTAC
CCGAAAACCGGAACCACGTGGCTCAAAGCCCTGACGTACGCCATCGTCAACCGCTCTCGCTTCGACGACGCCACGAACCC
GCTCCTCAAACGGAACCCTCACGAGTTCGTGCCTTACGTGGAGATAGACTTCGCGTTTTACCCGACCGTCGACGTCCTTC
AAGATCAAAAGAACCCACTATTCTCTACCCATATCCCAAACGGGTCGTTACCGGACTCGATAGTGAACTCCGGTTGCAAG
ATGGTTTACATCTGGAGAGACCCCAAGGACACGTTCATCTCCATGTGGACTTTCTTGCACAAGGAGAAGTCTCAAGAAGG
TCAGCTCGCGAGTCTTGAAGAGTCTTTTGATATGTTCTGCAAAGGCTTGTCCGTGTACGGTCCTTATCTTGATCATGTGT
TGGGTTACTGGAAGGCTTACCAAGAGAACCCTGAGAGGATTCTGTTCCTTAGGTACGAGACGATGAGAGCTAATCCTTTG
CCGTTTGTGAAGAGGTTGGCTGAGTTTATGGGTTATGGGTTTAGTGCTGAGGAAGAGGAGAAAGGGGTTGCGGAGAATGT
TGTGAAGCTTTGTAGTTTCGAGACGTTGAAGAATCTTGAAGCTAATAAAGGAGATAAGGAGAGGGAGGACCGTCCTGCGG
TTTATGCGAATAGTGCTTATTTTAGGAAAGGGAAGGTTGGAGATTGGGCGAATTATCTGACTCCGGAGATGGCTGCTCGT
ATCGATGGGTTAGTGGAAGAGAAGTTTAGAGATACTGGCTTGCTTGAACATGATCAGTGA