Details for Chinese cabbage Locus Brara.B02106

Position : A02 ( 5`- 13195003 .. 13197410 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.B02106

Protein [Map View]
MVRTPCCRAEGLKKGAWTHEEDHKLIAYVQLHGEGGWRTLPDKAGLRRCGKSCRLRWANYLRPDIKRGEFSQEEEDSIIR
LHAIHGNKWSAIARRLPGRTDNEVKNHWNTHIKKRLIKKGIDPLTHKSLNGKSSDHPETPPDKSSVHQDDDDQKSNKNNA
LGSLSARFLNRVANRFGKRINQSVLSDIIGSGDPFTSFTTPTTSASECEKSSSSFSKPNSSDLLINENMILDATSLSSST
FSSDTSDPSVYDHIFDDLEDMTAFSSRFLNDVVSHDDEDFLMLDESCLEKTSFMRELTRILQDDKIETTMCSDSRVTPIS
EVDVSFEGIDNYFG*

DNA
ATGGTACGGACACCGTGTTGCAGAGCTGAAGGGCTGAAGAAAGGAGCATGGACTCACGAAGAAGACCATAAGCTCATCGC
CTACGTCCAACTTCACGGTGAAGGAGGCTGGCGAACCCTTCCTGATAAAGCTGGTCTAAGAAGATGTGGCAAAAGCTGCA
GACTGAGATGGGCCAATTACCTTAGACCTGACATTAAGCGTGGTGAGTTTAGCCAAGAGGAGGAAGATTCCATCATTAGA
CTCCATGCCATTCATGGCAACAAATGGTCGGCGATAGCTCGTAGATTACCTGGAAGAACAGATAACGAGGTCAAGAACCA
CTGGAACACTCACATCAAGAAACGTCTGATCAAGAAAGGTATCGATCCGTTGACCCACAAATCACTTAATGGTAAATCAT
CTGACCATCCCGAGACACCGCCGGATAAAAGCAGCGTTCATCAGGATGATGATGATCAAAAGTCAAACAAGAATAATGCG
TTAGGATCATTATCAGCTCGGTTCTTGAACAGAGTAGCAAACAGATTTGGTAAAAGAATCAACCAAAGTGTTCTGTCTGA
TATTATTGGAAGTGGTGACCCATTTACTAGTTTCACTACTCCTACTACAAGTGCTTCTGAATGTGAAAAGTCATCGAGTT
CTTTCTCCAAACCAAACTCTTCAGATCTCCTCATTAATGAAAACATGATCCTCGATGCAACATCTTTGTCCTCGTCCACG
TTCTCTAGCGACACCTCTGACCCCTCAGTATACGACCATATCTTCGATGACTTAGAAGATATGACCGCATTTTCATCAAG
ATTTTTGAATGATGTTGTATCTCATGATGATGAAGATTTCTTGATGTTGGATGAATCTTGTTTGGAGAAAACTTCGTTCA
TGAGGGAACTTACAAGGATTCTTCAAGACGATAAAATTGAGACGACTATGTGTAGTGATAGTCGTGTGACACCAATCAGT
GAAGTTGATGTTTCCTTTGAAGGGATTGACAACTATTTTGGATAA