Details for Chinese cabbage Locus Brara.B02105

Position : A02 ( 5`- 13187618 .. 13189024 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.B02105

Protein [Map View]
MMLPNAKLSTPTSKFLPPPIEPQQHSRRTAAGASPSLELSCKLSRRNLSKSSLLLLLGTQTTLTPLLDLSKAQADTISQV
TDNPTSCGDRVSTKKAFLDVSIGGEPVGRIVIGLYGDDVPAGTARFSSIVSGKAGISYRRKEFVKIMPGYVQHGGIRSYG
ADAERATAAAGSLQNLVEEWERGRRGERCKEVKAGSVGIVVRDPLKPPPKTKLVATNGKLEVQEEEIAVGPNGTEFVITA
VDTPELEESVLVIGEVLEGMGVVEKMREVKTVRDNTSSPYFKVAKVIGDKRAVVAERGFNRPYTKVQVTNCGFIEPQDSQ
*

DNA
ATGATGCTACCCAATGCAAAACTCTCGACCCCAACCTCAAAGTTTCTACCGCCGCCTATAGAGCCACAGCAGCACAGCCG
GAGAACCGCCGCAGGAGCCTCTCCGTCGCTGGAACTGAGCTGTAAATTATCACGCAGGAATCTAAGTAAATCCTCGTTGC
TTCTACTCCTCGGCACTCAGACTACTCTGACGCCATTGCTCGATCTCTCTAAAGCACAAGCAGATACGATCTCTCAAGTA
ACTGATAACCCGACAAGTTGTGGAGACAGAGTTTCGACAAAGAAAGCGTTCCTCGACGTATCTATCGGCGGAGAACCAGT
TGGACGTATCGTCATCGGTTTATACGGCGACGATGTGCCGGCGGGAACGGCAAGATTCAGTAGCATTGTGAGCGGGAAAG
CAGGAATCAGTTACCGGAGAAAAGAGTTCGTGAAGATAATGCCAGGCTACGTCCAGCACGGCGGGATCAGATCGTACGGC
GCCGACGCAGAGCGAGCCACCGCAGCAGCTGGGAGTCTGCAGAACCTAGTGGAAGAATGGGAGAGAGGGAGGAGAGGAGA
GAGGTGCAAAGAGGTTAAGGCGGGAAGCGTGGGGATCGTGGTGAGGGATCCGTTGAAGCCGCCGCCGAAGACGAAGCTGG
TGGCGACTAACGGGAAGCTGGAGGTGCAGGAGGAGGAGATTGCTGTGGGGCCTAACGGAACGGAGTTTGTTATAACGGCG
GTGGATACGCCGGAGCTGGAGGAGTCGGTGTTGGTGATTGGGGAAGTGTTGGAAGGGATGGGAGTTGTGGAGAAGATGAG
GGAAGTTAAGACAGTGAGGGACAACACGAGTTCTCCTTACTTCAAGGTGGCTAAGGTGATCGGAGATAAGAGAGCCGTGG
TAGCGGAAAGAGGGTTTAATCGGCCATATACAAAGGTTCAGGTCACCAATTGTGGTTTCATTGAGCCACAAGACTCACAG
TAG