Details for Chinese cabbage Locus Brara.B02077

Position : A02 ( 5`- 12948533 .. 12949053 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.B02077

Protein [Map View]
MFTIGYECSDVLKAVASKDASGKLFKYDPSKRVVTVLLEGLSGSAGFAVSSDGSFVLVSQFTKSNIKRYWIKGSKAGTSE
DFTNAVSNPDNIKRIGSSGNFWVASVVNTATGPTNPSAVKINSDGRVLQTISVKDKFGDTLVSEVNEFEGRLYVGTLSGP
FAGIIDL*

DNA
ATGTTTACTATTGGTTATGAATGTAGCGACGTGTTAAAAGCAGTGGCATCAAAAGACGCTTCCGGGAAACTCTTCAAGTA
CGATCCATCAAAAAGGGTCGTGACTGTATTGCTCGAAGGTCTAAGTGGCTCAGCCGGTTTTGCCGTTAGCTCAGACGGTT
CGTTTGTGCTGGTTAGTCAGTTCACCAAGAGTAACATCAAGAGGTATTGGATCAAGGGGTCTAAAGCTGGTACTTCTGAA
GACTTCACTAATGCGGTCTCGAACCCTGACAATATCAAGAGGATCGGTTCTTCCGGAAACTTTTGGGTTGCTTCGGTAGT
GAACACAGCCACCGGACCAACAAACCCGTCTGCGGTTAAAATTAACTCTGATGGTAGAGTGCTTCAGACAATTTCGGTGA
AGGATAAGTTTGGAGATACTTTAGTCAGCGAGGTTAACGAATTCGAAGGAAGGCTTTATGTCGGAACTCTGTCTGGTCCT
TTTGCCGGAATTATTGACCTTTAA