Details for Chinese cabbage Locus Brara.B02074

Position : A02 ( 5`- 12925278 .. 12928891 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.B02074

Protein [Map View]
MVLESSVALSPRRRLGLLRDQVQLIKRKDSGRYEIVPIEDPLSFEKGFYAVIRACQLLAQKNDGLILVGLAGPSGAGKTV
FTEKILNFMPSIAIINMDNYNDGTRVIDGNFDDPRLTDYDTLLDNLHGLKDGKSVQVPIYDFKSSSRIGYRTLEVPSSRI
VILEGIYALSEKLRPFLDLRVSVTGGVHFDLVKRVLRDIQRAGQEPEEIIHQISETVYPMYKAFIEPDLKTAHIKIQNKF
NPFSGFQNPTYILKSTKAVTPEQMKAVLSEDFKERTEETYDIYLLPPGEDPEACQSYLRMRNRDGKYNLMFEEWVTDRPF
IISPRITFEVSVRLLGGLMALGYTIATILKRKSHIFDDEKVIVKTDWLEQLNRTYVQVQGRDRSFVENVANELGLEGSYC
PHTYIEQIQLERLVNDVMALPDDLKTKLSLDDDTVSSPKEALSRASADSRMKYLHGESSDLCIDARINSGVSKSYTNQRH
KVLPNLTRLAVNNRMLDARAPASPATLPNQGVITQLSDQISTLNERMDDFTSRIEELNSKIPNRIAASGSQHNLALPMEN
GNGSLLSLSSSQSQLVRESPLMEEVILVARGQRQIMHQMDTLSNLLREYVGERSRIERLDSNRTNSTTQNLEASTLPVLL
ALVVGCLGVFAYSRLK*

DNA
ATGGTGCTTGAGAGCTCCGTTGCTCTGTCACCACGACGGAGGCTCGGGTTGTTGCGTGATCAGGTTCAGCTTATCAAGAG
AAAAGACTCTGGAAGATACGAGATCGTTCCCATTGAGGATCCGTTGTCTTTTGAGAAGGGCTTCTACGCTGTGATTCGCG
CTTGCCAGCTGTTGGCTCAGAAGAACGATGGGCTCATCTTGGTTGGGTTAGCTGGGCCTTCTGGAGCTGGGAAGACTGTG
TTTACGGAGAAGATTCTTAACTTTATGCCTAGTATTGCTATTATAAATATGGATAATTACAATGATGGCACTCGTGTGAT
CGATGGGAACTTTGATGACCCGCGTTTGACTGACTATGATACTCTTCTTGATAATCTACATGGCTTAAAGGATGGAAAAT
CTGTTCAGGTTCCTATATATGACTTCAAGTCAAGCTCGAGAATTGGTTACAGAACGCTTGAGGTGCCTAGCTCTCGCATT
GTTATCCTTGAAGGCATATATGCTTTGAGCGAGAAGCTACGGCCTTTTCTAGATCTTCGTGTCTCTGTCACTGGTGGAGT
GCATTTTGATCTTGTCAAGCGTGTTTTGCGGGACATTCAACGTGCTGGCCAGGAACCTGAAGAAATCATTCATCAAATAT
CTGAGACGGTTTATCCTATGTACAAGGCGTTTATTGAACCAGACCTGAAGACAGCTCATATTAAGATACAAAACAAGTTT
AACCCCTTCAGTGGCTTTCAGAACCCAACTTATATTCTAAAGTCAACAAAGGCTGTAACACCAGAACAAATGAAGGCAGT
TCTGTCTGAGGATTTCAAGGAACGCACAGAGGAAACTTACGACATCTATCTGCTACCGCCAGGCGAGGATCCTGAAGCAT
GCCAATCATACCTCAGAATGAGGAACCGGGATGGAAAATACAATCTCATGTTTGAGGAGTGGGTTACAGATCGTCCATTT
ATTATATCACCCAGAATAACTTTTGAAGTCAGCGTTCGACTTCTGGGAGGATTAATGGCATTGGGTTATACCATTGCAAC
AATCTTGAAGAGAAAAAGTCATATCTTTGATGATGAGAAGGTTATTGTGAAGACTGATTGGTTGGAACAACTGAACCGGA
CATACGTTCAGGTACAAGGTAGAGACCGTTCCTTCGTCGAAAATGTGGCCAACGAACTCGGATTGGAAGGTTCATATTGT
CCACATACATATATTGAACAGATACAGTTGGAGAGGCTTGTGAATGATGTTATGGCTTTGCCAGATGACTTGAAGACTAA
ACTCAGCTTAGATGATGATACAGTTTCTAGTCCTAAAGAAGCCCTCTCAAGAGCTTCTGCTGATAGTAGAATGAAATATC
TTCACGGGGAATCATCTGACTTGTGTATTGATGCACGTATTAACAGCGGTGTGTCAAAGTCATACACAAATCAAAGACAC
AAAGTCTTGCCTAACTTGACAAGGCTTGCTGTTAACAATAGAATGTTAGATGCCAGAGCCCCTGCTTCACCAGCCACTCT
TCCAAATCAGGGTGTGATCACTCAGCTGTCAGATCAAATATCAACACTGAACGAGAGGATGGATGACTTCACATCCCGCA
TAGAAGAGTTAAACTCCAAGATTCCGAACAGGATAGCTGCATCAGGTAGTCAACACAACTTGGCTTTACCAATGGAAAAT
GGTAATGGGTCCCTCTTATCACTGTCCTCATCCCAATCTCAGCTTGTAAGGGAGTCTCCTCTGATGGAAGAGGTTATACT
GGTTGCTCGTGGACAACGTCAGATAATGCATCAAATGGACACACTGAGCAATCTCCTCAGGGAGTATGTTGGAGAAAGGT
CTCGCATAGAGAGACTAGACAGCAACAGAACAAACAGCACAACACAGAACCTCGAAGCCTCCACTTTACCTGTTCTTCTT
GCTTTGGTCGTTGGCTGTCTCGGCGTTTTTGCCTACAGTCGTCTCAAGTAG