Details for Chinese cabbage Locus Brara.B02073

Position : A02 ( 5`- 12922570 .. 12925136 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.B02073

Protein [Map View]
MSRSPSFSVKPELTIKPDLASLSRWVHSFCIMRFDLEQGQILEESYPPNRLSQEEEIEVSFNSFPDSVSQKQHNRSSIHD
CIFFFRFRRDDNNNYLYGYVFNRQRHDERLKRGGEQKSVVILSHAPYSSVFRPLLQIIGPLYFDVGNKAIEHVAGFVSLW
PPPVPGKLMELPIGNATLKVNLPPPHSLPLENNGVLYEESASSMAPLLPTNQSVPQGLFHDADLFGVYRGLLLQLWTLWE
LLLIGEPILIIAPTPPQCSEAVACLVSLVAPLFCSVDFRPYFTIHDPGFARLNSLREGDAFPPMVLGVTNLFFLKALRNM
PHVVSVGTPSLNSNRVPFSSRSSAGRLPGGKSSEGLGVQQLSLRRFSPTNLLNAVKLRRDGPLCLMTEHKEAVWTSYAAI
TKPDTSVLNRLVDAGMSPRVEESMSVVNNEILRRHFLELTTNFLAPFGPYFQVNAPSDGSSPYVAPPPLPSFSADEFLSN
LSARGVGKFLSKRMKSNWPDLYRRFLQGPNFVPWFQRRRAVAEQEQRRLWKVARMRTDMRLITSQMNELEAVDSFDAIEK
YINEEVKLRESGGGSADSEASFEKLKKDLQAVFSVLPRDMQELLLSNPQRASLLQDPSELQ*

DNA
ATGAGTCGCTCTCCATCCTTCTCCGTGAAGCCCGAGCTAACCATCAAACCCGATCTCGCCTCTTTATCGCGATGGGTCCA
CTCCTTCTGCATAATGAGATTCGATCTCGAGCAAGGCCAGATCCTAGAAGAGTCCTACCCGCCTAACCGCCTCTCCCAAG
AAGAAGAGATCGAAGTCTCCTTCAACTCCTTCCCCGACTCCGTCTCCCAGAAACAACACAACCGCTCCAGCATCCACGAC
TGCATCTTCTTCTTCCGCTTCCGTCGAGACGACAACAACAACTACTTGTACGGTTACGTGTTCAACAGGCAGAGACACGA
CGAGAGGCTGAAACGAGGAGGCGAGCAGAAGTCCGTTGTCATACTCTCCCACGCGCCTTACTCTAGCGTCTTTCGTCCCT
TGCTTCAGATCATCGGTCCTTTGTATTTCGATGTTGGGAACAAAGCTATTGAACATGTAGCTGGCTTCGTCTCTTTATGG
CCTCCTCCTGTTCCCGGGAAGCTCATGGAGCTTCCCATTGGTAACGCCACGCTCAAGGTCAACTTGCCTCCTCCTCATAG
CCTTCCTTTGGAGAATAACGGCGTGTTGTATGAAGAGTCTGCTTCCTCCATGGCTCCTTTGCTTCCTACGAACCAGTCTG
TTCCTCAAGGGCTTTTCCACGACGCGGATCTGTTTGGTGTTTACAGAGGGCTGTTGTTGCAGCTTTGGACTCTGTGGGAG
TTGTTATTGATTGGGGAACCTATTCTCATTATAGCGCCGACGCCGCCGCAGTGTTCTGAGGCAGTTGCTTGTCTTGTGAG
TCTTGTTGCGCCGTTGTTTTGTAGCGTTGACTTTAGACCTTATTTCACTATACATGATCCTGGTTTCGCTAGACTAAACT
CGCTCCGGGAAGGAGATGCTTTCCCTCCTATGGTTTTGGGTGTTACTAATCTCTTTTTCCTCAAAGCGCTTCGGAACATG
CCGCATGTTGTCTCTGTTGGAACTCCTTCTCTGAACTCAAACCGTGTGCCGTTTTCGAGTAGGTCTTCTGCTGGGAGATT
ACCCGGTGGTAAGTCTTCTGAAGGGTTAGGTGTTCAGCAGCTTTCCTTGAGAAGATTCTCTCCTACAAACTTGCTAAATG
CGGTGAAGCTTAGGAGAGATGGACCGTTGTGTCTTATGACGGAGCACAAGGAAGCTGTCTGGACGAGTTACGCTGCGATT
ACGAAGCCGGATACTTCGGTTTTGAATAGGCTTGTTGATGCTGGGATGTCTCCGAGAGTTGAGGAGTCTATGTCTGTTGT
GAATAATGAGATTCTGCGGCGGCATTTCTTGGAGTTGACTACCAACTTCTTGGCTCCTTTTGGTCCGTACTTTCAGGTTA
ACGCTCCTTCTGATGGATCTTCCCCTTATGTCGCCCCTCCTCCGCTTCCGTCCTTCAGTGCTGATGAGTTTCTTTCGAAC
TTATCCGCGAGAGGTGTGGGGAAGTTTTTGTCTAAACGCATGAAATCAAACTGGCCTGACTTGTATAGGCGGTTTCTACA
AGGGCCTAATTTTGTCCCATGGTTCCAGAGACGGCGGGCTGTAGCTGAGCAAGAACAACGTAGATTGTGGAAGGTGGCTA
GAATGAGGACTGATATGCGGCTGATTACATCTCAGATGAATGAATTGGAAGCTGTGGATTCCTTTGATGCCATTGAGAAG
TACATTAATGAGGAAGTCAAGTTGAGGGAATCAGGAGGAGGCAGTGCAGATTCAGAAGCAAGTTTTGAGAAACTGAAGAA
GGATTTACAGGCGGTGTTCAGTGTACTACCAAGGGACATGCAAGAACTTTTGCTCTCAAATCCGCAAAGAGCATCACTTC
TTCAAGATCCATCAGAGCTCCAATGA