Details for Chinese cabbage Locus Brara.B02072

Position : A02 ( 5`- 12921192 .. 12921912 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.B02072

Protein [Map View]
MSSSYILCITLLIFKSPIFLQLVLAQVPATCASMLLSLAPCGPFVQGFVQLPAQPCCNGLNQIYSQQPSCLCLLLNNTST
VSPAFPINQTLALQLAPLCNIPANSSSCSSLAPSNSSSVAPPPSSSTGSQVSIGAKNNSSVKAIATPVAPRPTSFLGLGY
GLRSSGFKSEIQLNLSEY*

DNA
ATGTCTTCTTCTTATATTCTATGTATTACTCTCTTAATCTTCAAGTCTCCAATCTTTCTACAACTGGTTCTCGCTCAAGT
TCCAGCTACATGTGCCTCCATGCTTCTTTCCTTGGCTCCATGTGGTCCATTCGTCCAAGGCTTTGTCCAGCTTCCTGCTC
AGCCCTGTTGTAACGGCTTAAACCAAATCTATAGCCAACAACCGAGCTGTCTCTGTCTCTTACTCAACAATACCTCTACT
GTTTCCCCTGCTTTTCCAATTAATCAAACTCTCGCTCTACAACTGGCTCCACTTTGCAACATTCCAGCAAATTCATCCTC
TTGCTCCTCCCTAGCGCCTAGTAATTCCTCCTCTGTTGCTCCACCACCTTCAAGCTCAACCGGTTCTCAAGTTTCTATAG
GTGCAAAGAACAACTCTAGTGTCAAGGCAATCGCAACCCCAGTGGCACCAAGACCCACTAGCTTTCTGGGGCTAGGTTAT
GGTCTGAGATCCTCTGGCTTCAAGTCTGAGATTCAACTGAATCTGTCTGAATATTAA