Details for Chinese cabbage Locus Brara.B02070

Position : A02 ( 5`- 12900799 .. 12902085 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.B02070

Protein [Map View]
MANLSSDFQTFDPITQLAELNNTLNHFQTMFASPFSSSLDSLFFHHQQHQQFPEHFPGKSPENNGFHQGILLPNYNTHNN
DDSSSGIDTKKRKTLMESVSTSENSVSDQTLSTSSAQVSTNGTKNSSLRRGKMSKNREEEKERVYVRRGKINERLKCLKD
IVPGCYKAMGMATMLDEIINYVQSLQNQVEFLSMKLTAASSYYDFNSEADAVDSMQKAKAREAVEMGQGRDGSRVFHSSS
WTL*

DNA
ATGGCGAATCTCTCTTCTGATTTTCAGACATTCGATCCCATAACTCAACTTGCAGAACTCAACAACACTCTTAACCACTT
TCAGACAATGTTCGCTTCTCCTTTCTCTTCTTCTCTCGACTCTCTTTTCTTTCATCACCAACAACACCAACAATTTCCGG
AACATTTCCCCGGAAAATCCCCCGAAAACAATGGTTTTCATCAAGGGATTTTACTCCCTAATTATAATACTCACAACAAC
GACGATTCTTCTTCAGGAATCGATACCAAGAAGAGAAAAACATTAATGGAGTCCGTATCTACGTCGGAGAACAGTGTCTC
TGATCAAACTTTATCTACCTCTTCTGCTCAAGTTTCGACTAATGGAACCAAAAATAGTTCTTTAAGGAGAGGGAAAATGT
CAAAGAACAGAGAAGAAGAGAAAGAGAGAGTATATGTTAGACGAGGGAAAATAAACGAGAGATTGAAATGCCTGAAAGAT
ATAGTGCCCGGATGTTATAAGGCAATGGGAATGGCTACGATGCTGGACGAGATAATTAATTATGTCCAGTCGTTACAAAA
TCAAGTTGAGTTTTTATCTATGAAGCTTACGGCAGCAAGTTCGTATTATGACTTTAACTCGGAGGCTGATGCTGTTGATT
CCATGCAGAAGGCAAAGGCACGTGAGGCAGTAGAAATGGGGCAAGGGAGGGATGGGAGCAGGGTCTTCCATTCATCATCA
TGGACCCTTTGA