Details for Chinese cabbage Locus Brara.B02069

Position : A02 ( 5`- 12894750 .. 12895046 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.B02069

Protein [Map View]
MKFSCSKPVLFTCAILLLLIVAQENRVVAGQSCDPMQLIPCEEAILKGSKPSDTCCTRLNQQQHCVCQYMKNPNFKSFLD
SPNAKKIATDCHCPKPKC*

DNA
ATGAAGTTTTCTTGCTCAAAACCAGTGTTGTTCACTTGTGCAATCCTTCTCTTGCTCATTGTTGCTCAAGAAAACAGAGT
TGTTGCAGGACAGTCATGTGACCCTATGCAGCTTATCCCATGCGAGGAGGCCATACTGAAAGGCTCTAAGCCGTCGGATA
CATGTTGCACCAGGCTGAACCAGCAACAACACTGTGTCTGCCAGTACATGAAGAACCCCAATTTCAAATCTTTCCTCGAC
TCACCAAATGCTAAAAAAATCGCCACTGATTGTCATTGTCCTAAACCCAAGTGCTAG