Details for Chinese cabbage Locus Brara.B02067

Position : A02 ( 5`- 12884733 .. 12886655 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.B02067

Protein [Map View]
MSVADIRMENEPDDIASDNVAEIDVSDEDIDAEDLERRMWKDRVRLKRIKERTKSGSQAKEAPKKISDQAQRKKMSRAQD
GILKYMLKLMEVCKVRGFVYGIIPEKGKPVSGSSDNIRAWWKEKVKFDKNGPAAIAKYEEECIAFGKSDRNRNSQFVLQD
LQDATLGSLLSSLMQHCDPPQRKYPLEKGTPPPWWPTGDEEWWVKLGLGKSQSPPYRKPHDLKKMWKVGVLTAVINHMLP
DVAKIKRHVRQSKCLQDKMTAKESAIWLAVLNQEESLVQQNSSDNGTSNVTEIRRRGNNNAENMVNSDGDYDVDGTEEAS
GSLTATSQPVRDQDKAKKQRRRKRPRSISGTVSRQEEEQRNILPDMYHVDASLLGHNINGTHHHQEGVLEPNIALGAEEN
GLEVIVPEFDNNYTYFPPVSEQAMMPVDERPMLYGPNPNQELQFGSGYNFYNPSAVLVNNQEQDLIHTRIEMNAPRSNGF
EASVGVGAPDGLHEDGVAGRDLPPQFQRDSNILSPFNDLAAFDSSTFYSGFDSYGAFDDDFSWFGA*

DNA
ATGTCCGTAGCAGACATCAGGATGGAGAACGAGCCTGATGACATAGCTAGCGACAATGTAGCAGAGATTGACGTGAGTGA
TGAAGACATTGATGCGGAAGACCTTGAGAGAAGGATGTGGAAGGATCGTGTACGCCTCAAAAGAATCAAAGAACGAACTA
AAAGCGGTTCTCAAGCGAAGGAAGCGCCCAAGAAGATCTCTGACCAAGCGCAGAGGAAGAAAATGTCTAGAGCACAAGAC
GGTATACTCAAGTACATGCTAAAGCTAATGGAAGTCTGCAAAGTCCGCGGGTTTGTGTACGGCATCATACCCGAAAAGGG
GAAGCCGGTGAGCGGCTCCTCCGACAATATAAGAGCTTGGTGGAAGGAGAAAGTGAAGTTTGATAAGAACGGGCCAGCTG
CGATTGCTAAATACGAAGAGGAGTGTATAGCGTTTGGGAAGTCAGACCGGAATAGAAACTCACAGTTTGTTCTGCAAGAC
TTGCAAGACGCTACTTTAGGGTCTTTGCTGTCTTCTTTGATGCAGCATTGTGATCCTCCTCAGAGGAAGTATCCGTTGGA
GAAAGGGACTCCTCCTCCGTGGTGGCCGACGGGGGATGAAGAGTGGTGGGTGAAGCTTGGTCTGGGTAAAAGCCAGAGTC
CTCCTTATAGGAAGCCGCACGATCTCAAGAAGATGTGGAAAGTTGGGGTTTTGACGGCGGTGATCAACCATATGTTGCCT
GATGTTGCGAAGATTAAGAGGCATGTTCGTCAGTCTAAGTGTTTGCAGGATAAGATGACGGCGAAAGAGAGCGCGATTTG
GTTGGCGGTTTTGAACCAAGAGGAGTCCTTGGTTCAGCAGAATAGTAGTGATAATGGAACATCTAATGTAACTGAGATAC
GCCGGAGAGGTAATAATAACGCTGAAAATATGGTCAACAGTGACGGTGATTATGATGTTGATGGGACAGAGGAGGCTTCA
GGTTCACTAACAGCTACGTCGCAGCCAGTAAGAGATCAAGACAAAGCAAAGAAACAAAGGAGAAGGAAAAGACCAAGAAG
CATATCAGGAACTGTCAGTAGACAAGAGGAAGAACAGAGAAATATTTTACCTGACATGTATCATGTTGATGCCTCTCTGC
TAGGACATAACATCAACGGTACTCATCACCATCAGGAAGGTGTTCTAGAGCCAAACATTGCCTTAGGAGCAGAGGAGAAC
GGTCTGGAAGTGATAGTTCCTGAGTTTGATAACAACTATACTTATTTTCCACCTGTCAGTGAACAAGCTATGATGCCTGT
AGACGAGAGGCCAATGCTTTACGGACCAAACCCTAACCAGGAGTTGCAGTTTGGGTCAGGTTACAACTTCTATAATCCCT
CTGCAGTGCTTGTGAATAATCAGGAACAAGACCTCATCCATACGCGGATAGAAATGAACGCACCTCGCAGCAACGGATTT
GAGGCCTCAGTAGGTGTAGGTGCACCTGATGGTTTACATGAAGACGGTGTAGCAGGAAGAGATTTGCCTCCTCAGTTTCA
GAGGGACAGTAACATTCTGTCTCCATTCAATGACTTGGCGGCGTTTGATAGTAGCACATTTTACTCTGGGTTTGATTCGT
ATGGTGCATTTGATGATGACTTCTCATGGTTTGGAGCTTAG